KEGG   Serratia fonticola GS2: AV650_09415Help
Entry
AV650_09415       CDS       T04716                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sfg  Serratia fonticola GS2
Pathway
sfg00473  D-Alanine metabolism
sfg01100  Metabolic pathways
sfg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sfg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AV650_09415
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    AV650_09415
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sfg01011]
    AV650_09415
Enzymes [BR:sfg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AV650_09415
Peptidoglycan biosynthesis and degradation proteins [BR:sfg01011]
 Precursor biosynthesis
  Racemase
   AV650_09415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ALX93756
UniProt: A0A0U4IF45
LinkDB All DBs
Position
complement(2076972..2078204)
Genome map
AA seq 410 aa AA seqDB search
MPLHLRHLVLIPLLTLVACHQPAATNPTHSLTATVKSSPAAVVSNARLEISQSALEYNTH
KIQQLLGDKTTLCAILKGDAYGHDLSLVAPVMIKNHVQCIGVASNQELQTVRELGFKGRL
MRVRNATEAEMRQATDYDTEELIGNLEMAKRLDAIAAQQGKTLRFHLALNSGGMSRNGLE
VSEAAGLTEAKAISALPHLKMVGIMSHYPEEDAAAVRKDLARFKVQSQQVLDITGIKRSD
VTLHVANTFATLTVPESWLDMVRVGGVFYGDTIASNDYKRVMTFKSSIAALNHYPKGNTV
GYDRTYTLKRDSVLANIPVGYADGYRRVFSNAGHVLIQGQRVPVVGKTSMNTVMVDVTDV
KGVTPGDEVVFFGKQGNAEITATEVEDISGALFTEMSILWGATNKRVLVD
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgcatttacgccatttagtcttaataccgctattaacgttggtggcttgccat
caacctgctgccaccaatcccactcattctctcaccgctacggttaaaagttcaccggcg
gcggtggtaagcaatgcccggttggaaatctcacaaagcgcgctggaatataacacccac
aaaattcagcaactgttgggcgataaaactaccctttgcgccattctgaaaggagatgcc
tacgggcacgacctttcgttggtggcacccgtgatgatcaagaatcacgtgcagtgcatt
ggcgtggccagtaaccaagagctgcaaaccgtgcgcgaactcggctttaaaggccgcctg
atgcgcgtgcgcaatgccaccgaagcagagatgcgccaggctaccgactatgacaccgaa
gagctgatcggtaatctggagatggcgaaacgcctggatgccattgccgcccaacagggc
aaaaccctgcgcttccatttggcactgaactctggcggtatgtcacgtaacggcctggaa
gtcagcgaagctgccggattgactgaagccaaggctatctctgcattaccccatctgaaa
atggtcggcatcatgtcccactatcctgaggaagatgcagcggcggtgcgcaaggatctt
gcccgctttaaggtgcaatcccagcaggtgctagacattaccgggatcaaacgcagcgac
gtgaccttacacgttgccaatacctttgcgaccctcaccgtgccggagtcctggcttgat
atggtgcgcgttggcggggtgttttatggcgataccattgccagtaacgactataaacgc
gtgatgaccttcaagtcatccatagcggcactcaaccattaccctaaaggcaataccgtc
ggttacgatcgtacctacaccctgaaacgcgattcagtattggcgaacatcccagtgggt
tatgccgacggttatcgccgtgtgttcagcaatgccggtcatgtattgatccaggggcag
cgggtgccggtggtgggtaaaacctcgatgaataccgtaatggtggatgtgaccgacgtg
aaaggcgtcactcctggtgatgaggtggtgttcttcggcaagcagggtaatgcagagatc
accgccactgaagttgaagacatcagcggtgcgctgtttaccgagatgtcgatcctttgg
ggcgcgaccaataagcgtgttctggtggattaa

DBGET integrated database retrieval system