KEGG   Serratia fonticola GS2: AV650_13450
Entry
AV650_13450       CDS       T04716                                 

Gene name
rlmL
Definition
(GenBank) 23S rRNA methyltransferase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
sfg  Serratia fonticola GS2
Brite
KEGG Orthology (KO) [BR:sfg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sfg03009]
    AV650_13450 (rlmL)
Enzymes [BR:sfg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     AV650_13450 (rlmL)
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     AV650_13450 (rlmL)
Ribosome biogenesis [BR:sfg03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AV650_13450 (rlmL)
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_31 Methyltransf_25 Methyltransf_11 MTS Methyltransf_15 N6_Mtase Methyltransf_24
Other DBs
NCBI-ProteinID: ALX94502
UniProt: A0A0F7HD53
LinkDB
Position
2957658..2959814
AA seq 718 aa
MRNNFLFGDKHDMNTLFASTARGLEELLKSELERLGAHSCKVVQGGVHFQGDDRLLYQSL
LWSRLASRILLPLNEFRVHSDLDLYLGVQAIDWPSIFGLDKTFAVHFSGLNEEIRNSQYG
ALKVKDAIVDSFTRKLNDRPMVEKQQPDIRVNVFLQRDMASVALDLSGEGLHQRGYRDLT
GQAPLKENLAAAIVQRSGWQPGAPMLDPMCGSGTLLIEAAMIASDRAPGLHRQHWGFTAW
NGHNAELWREVITEAQVRAKRGLQETPSRFFGSDIDRRVIEMAKGNARRAGVAELITFNV
NDVSKLTNPLPEGPVGTVVSNPPYGERLESEPALIALHNMLGRIMKSHFGGWQLSLFSAS
PELLSCLQLRAERQFKAKNGPLDCVQKNYQLAENPQGAGGVQVAEDFANRLRKNLKKLDK
WAKQQGIECYRLYDADLPDYNVAVDRYGSKVVVQEYAPPKTIDAQKARQRLFDVINATLA
VLELPSNQLILKTRERQKGKNQYEKLAQKGEFLLVEEFNAKLWVNLTDYLDTGLFLDHRI
ARRMLGEMSKGKDFLNLFAYTGTASVHAGLGGARSTTTVDMSRTYLEWAEKNLRVNGLTG
RQHRLIQADCLSWLHNADEQFDVIFIDPPTFSNSKRMENTFDVQRDHLALMKDLQRILRR
NGTIMFSNNKRGFQMDLAGLNALGLEAKEITAKTQSEDFARNRQIHNCWLVTHAGEGK
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgcgcaacaattttctttttggtgataagcacgatatgaacactctgtttgccagcacg
gcgcgtggactggaagaactgttaaaaagcgaactggagcggcttggcgctcactcctgc
aaagtggtgcaggggggagtacattttcagggtgacgatcgtcttctgtaccaaagcctg
ctctggagccgcctggcttcgcgtattctgttgccgctgaatgaatttcgcgtgcacagc
gatttggatctgtacctcggtgtgcaggccattgactggccatcgatatttggcctggat
aaaacctttgccgtgcacttcagcggcctcaatgaagagatccgcaatagccaatatggt
gcgctgaaggtcaaagacgccattgtggacagctttacccgcaagctcaacgatcggcca
atggtagagaaacagcagccggacattcgggtgaacgttttcctgcagcgtgatatggcc
agcgtagcgctcgatctgagcggagaaggtttgcaccagcgcggctatcgcgatcttacc
ggccaggctccattgaaggaaaacctggcggcagcgattgtccaacgttccggttggcaa
ccaggggcgccgatgctggacccgatgtgcggctctggcacgctgttgatcgaagcggcg
atgatcgcctccgatcgcgcgcctggcctgcatcgccaacattggggctttaccgcctgg
aacggccacaatgccgaactgtggcgtgaagtgatcaccgaagcgcaggtgcgtgcgaaa
cgtggcctgcaagaaaccccgtcacgcttctttggttcggatatcgatcgccgcgtcatt
gaaatggcgaaggggaacgcccgccgcgctggcgtggccgaattgatcacctttaacgtt
aatgacgtcagcaaactgaccaacccactgccggaaggcccggtaggcacggtggtcagc
aacccgccatacggtgaacgccttgagagcgaaccagccctgattgcgctgcacaatatg
ttagggcgcatcatgaagagccactttggtggctggcagctttcgttgttcagcgcctca
ccggaactgctcagttgcttgcagctgcgcgcagagcgccagttcaaagcaaaaaacggc
ccgttggactgcgtacagaaaaactaccagctggcagaaaacccgcagggtgctggtggc
gtgcaggtggcggaagactttgccaaccggctgcgcaagaatctgaagaaattggacaaa
tgggcgaagcagcaggggatcgagtgctatcgcctgtatgatgccgatctgcctgactat
aacgtggcggtggatcgctatggcagtaaggtggtggtgcaggagtacgcgccgccgaaa
accatcgacgcgcagaaagcccgccagcgcctgtttgacgtgattaacgccacgctagcg
gtactggagctgccttcgaatcagctgatcctgaaaacccgcgaacgtcagaagggcaaa
aatcagtatgagaagctggcgcagaagggggagttcctgctggtagaagagttcaatgcc
aagctgtgggtcaacctgacggattatctcgataccgggttattcctcgatcaccgcatc
gctcgccgtatgctgggtgagatgagcaaaggcaaagacttcctcaacctgtttgcctac
accggcactgcaagcgtacatgccgggttggggggcgcacgcagcaccaccacggtggat
atgtcgcgtacctatctggaatgggcggagaagaacctgcgggttaacggcctgaccggt
agacagcaccgcctgatccaggcagattgcctgtcctggctgcacaatgccgacgaacag
ttcgatgtgatctttatcgatccgccgacgttctccaactctaagcggatggagaacacc
tttgacgtacagcgcgaccatctggcgctgatgaaagatttacaacggatactgcgtcgt
aacgggaccatcatgttctccaacaacaaacgcggtttccagatggatctggcaggtctg
aacgcactgggtctggaggcgaaagaaattaccgccaagacacagtcagaagattttgcc
cgtaaccgtcagatccacaactgctggctggtcacccacgccggcgaaggaaaataa

DBGET integrated database retrieval system