KEGG   Serratia fonticola GS2: AV650_16110Help
Entry
AV650_16110       CDS       T04716                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sfg  Serratia fonticola GS2
Pathway
sfg00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sfg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AV650_16110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfg02000]
    AV650_16110
Enzymes [BR:sfg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AV650_16110
Transporters [BR:sfg02000]
 Other Transporters
  Pores ion channels [TC:1]
   AV650_16110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_3 GST_N_2 GST_C_2 GST_C_6 Glutaredoxin2_C
Motif
Other DBs
NCBI-ProteinID: ALX94981
UniProt: A0A0F7HFW8
LinkDB All DBs
Position
complement(3488282..3488884)
Genome map
AA seq 200 aa AA seqDB search
MKLFYKAGACSLSPHIVLREAGLDFTAEKVDLAHKKTESGADYLAINPKGQVPALVLDDG
SLLTEGVAIVQYLADRVPDRNLIPAAGTLSRYHAIEWLNYVATELHKGFSPLFNPKTPDE
YKAIARDKLASQFSYLDSVLEKQHYLLGQRFSVADAYLFTVLRWAKALQFDLTKHAHLTA
YFDRVAARPAVAATLSAEGL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttctataaagctggcgcctgttccctgtccccccacatcgtattacgtgag
gccgggttggatttcaccgcagagaaagtcgatttagctcacaagaaaaccgaaagtggt
gccgactatctggcgatcaacccgaaggggcaagtcccggcgttggtacttgacgatggc
agcctgctgaccgagggcgtggcgattgtgcaatacctggcggatcgcgtaccggatcgt
aacctgatcccggccgctggcacgctttctcgctatcatgcgatcgaatggctgaactac
gtggccaccgagttgcacaaaggcttcagcccgctgtttaacccgaagacaccggacgaa
tacaaagcgattgcccgcgataagctggctagccagttcagctacctggattcagtgctg
gagaagcagcattacctgttgggccagcgtttcagcgtggcggacgcgtatctgttcacc
gtgttgcgttgggcgaaggcgttacagtttgatctcacgaagcacgcacacctgacggct
tatttcgatcgcgtagcggctcgcccggcagtggcagccacgttgagtgccgaaggtcta
taa

DBGET integrated database retrieval system