KEGG   Serratia fonticola GS2: AV650_17075Help
Entry
AV650_17075       CDS       T04716                                 

Definition
(GenBank) beta-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
sfg  Serratia fonticola GS2
Pathway
sfg00061  Fatty acid biosynthesis
sfg00780  Biotin metabolism
sfg01100  Metabolic pathways
sfg01212  Fatty acid metabolism
Module
sfg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sfg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AV650_17075
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AV650_17075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sfg01004]
    AV650_17075
Enzymes [BR:sfg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     AV650_17075
Lipid biosynthesis proteins [BR:sfg01004]
 Fatty acid synthase
  Component type
   AV650_17075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT_2
Motif
Other DBs
NCBI-ProteinID: ALX95157
UniProt: A0A0U4HIX7
LinkDB All DBs
Position
complement(3717635..3718222)
Genome map
AA seq 195 aa AA seqDB search
MANYNKSLVQPNLLLKMGSWRAPIFMVDRIVDFSPGERGSITVIKHVTFNESYIPGHFPD
NPVMPGVMIAEIFGQSSEYLSLLNDFCQLHERETQQPLKKFDEVSRALQTPEGTARVIAE
RARVLGVLASQDVKYKSMVAPGDTIEVNSRLAFADMNGFHHYEVEARVGRNVACVGRIVN
FRTDRILAEGKGMYV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggctaattataacaagagcttagtccagcccaatctgctgctgaaaatggggtcctgg
cgtgcaccgatatttatggttgaccgcatcgtggacttttcaccgggagaaaggggctcg
attaccgtgatcaagcacgtcacctttaatgaatcctatattccggggcattttccagac
aacccggtaatgcctggcgtgatgatcgccgagatcttcggccagtctagtgaatatctg
agtttgctgaacgatttctgccagttgcatgagcgtgaaacccagcaaccgttgaagaaa
tttgatgaggtatcacgggcgttgcagacgccagagggcacggcacgagtgatagccgag
cgggcgcgcgtgttaggcgtgctggcctctcaggacgtcaagtacaaaagcatggtcgcg
ccgggcgacaccattgaagtcaacagccgcctggcgttcgccgatatgaacgggttccac
cactacgaagtggaggcgcgggttggccggaatgtggcgtgcgtcgggcggatcgtcaat
tttcgtaccgatcgcattctggctgaaggcaaaggtatgtacgtttaa

DBGET integrated database retrieval system