KEGG   Serratia fonticola GS2: AV650_20485Help
Entry
AV650_20485       CDS       T04716                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sfg  Serratia fonticola GS2
Pathway
sfg00250  Alanine, aspartate and glutamate metabolism
sfg00410  beta-Alanine metabolism
sfg00430  Taurine and hypotaurine metabolism
sfg00650  Butanoate metabolism
sfg01100  Metabolic pathways
sfg01110  Biosynthesis of secondary metabolites
sfg01120  Microbial metabolism in diverse environments
sfg02024  Quorum sensing
Module
sfg_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sfg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AV650_20485
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AV650_20485
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AV650_20485
   00430 Taurine and hypotaurine metabolism
    AV650_20485
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AV650_20485
Enzymes [BR:sfg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AV650_20485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ALX95772
UniProt: A0A0U4IL64
LinkDB All DBs
Position
4448972..4450372
Genome map
AA seq 466 aa AA seqDB search
MSTNNQENNSNVNDDVYSSIDLAISLPKSGFPDSERNPRHVFSAIRDELMLDGNSRQNLA
TFCQTWVDEEIRDLMDLSIDKNMIDKDEYPQTAEIEARCVRMLADLWKSPSPDTTLGCST
IGSSEAAMLGGLALKWQWRKKRVAQGLTTDKPNMICGPVQICWHKFARYFDVELREIPLE
GDRLIMSPEEVLKRVDENTIGVVPTLGVTFTCQYEPVKAVSDALDKLQKDTGLDIPIHVD
GASGGFLAPFCAPDLEWDFRLPRVKSINTSGHKFGLAPLGAGWVVWREATDLPEELIFNV
NYLGGNMPTFALNFSRPGGQIIAQYYNFLRLGREGYAKVHNACYATAQYLADEIGKLGPF
EILFDGDSAKGIPALAWKLKEGANIGGYTLYDLADKLRSRGWQVPAYSMPANREDLVIQR
ILVRHGVSFDLGSLLLDDLKRALEHFENHPVVNPLSEDEAAGFNHG
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaaacaaccaggaaaataacagcaatgttaatgatgatgtttactcctcgata
gatttggccatttcgctaccaaaatctggatttccagactcagagcgaaatcctcgccat
gtattcagtgccattcgcgatgaattaatgttggacggtaactcacggcaaaacctggcg
acattctgccaaacctgggttgacgaagaaattcgtgatctgatggatctgtctatcgac
aaaaatatgattgataaagacgagtatccacaaacggccgaaattgaagcccgctgcgtg
cgcatgttggccgacctgtggaaatcaccgtcgccggacaccacgctgggctgctccacc
attggctcgtcagaggccgctatgttgggggggttggcgttaaaatggcaatggcgcaaa
aagcgtgtcgcacagggcctaaccaccgataagcccaatatgatctgcgggccggtacaa
atttgctggcacaaattcgcgcgttatttcgacgtggaattgcgagaaattccactggag
ggcgatcgtctgatcatgagcccggaagaggtactgaaacgagtcgatgaaaataccata
ggtgtggtacccaccctcggagtgacctttacctgccagtacgagccggtaaaagcggtc
agcgacgcactcgataagctgcaaaaagacaccggactggatattcctattcatgtcgac
ggtgccagcggcggctttctcgccccattctgtgcccccgatctggaatgggatttccgc
ctgccacgcgtaaaatccatcaatacttcaggccataaatttgggttagcccctctggga
gcgggctgggtggtgtggcgtgaagcgacagacttgcccgaagagcttattttcaacgtc
aactatcttggcggcaatatgcctacctttgcgctcaacttctcgcgccctggtggacag
atcatcgctcaatactacaacttcttacgccttggccgcgaaggctacgccaaagtgcat
aatgcctgctatgccacggcccagtatcttgctgacgagatcggtaagctcggcccgttt
gaaatcctgtttgatggcgacagcgccaaaggcatcccggcgctggcatggaaactgaaa
gaaggcgccaacatcggtggctacacgctgtatgacctcgccgacaaattacgttcacgc
ggttggcaggtcccggcatactccatgccagctaatcgggaagatctggttatccagcgt
attcttgtacgccacggggtgagttttgacctgggtagtctgttgcttgacgatctgaaa
cgagcgcttgagcatttcgaaaatcatccggtcgttaatccactttcggaagatgaagcg
gccggttttaaccacggctga

DBGET integrated database retrieval system