KEGG   Serratia fonticola GS2: AV650_23305Help
Entry
AV650_23305       CDS       T04716                                 

Definition
(GenBank) glutaminase A
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
sfg  Serratia fonticola GS2
Pathway
sfg00220  Arginine biosynthesis
sfg00250  Alanine, aspartate and glutamate metabolism
sfg00471  D-Glutamine and D-glutamate metabolism
sfg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AV650_23305
   00220 Arginine biosynthesis
    AV650_23305
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AV650_23305
Enzymes [BR:sfg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     AV650_23305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ALX96278
UniProt: A0A0U4IS22
LinkDB All DBs
Position
complement(5067732..5068670)
Genome map
AA seq 312 aa AA seqDB search
MTIDLQRLQQVASNAYAQYSTLSGGENASYIPFLASVPSHLAALAIVTVDGDIISQGDAE
FRFALESISKVCSLALALEDVGPQDVQDKIGADPTGLPFNSVIALELHKGKPLSPLVNAG
AMSTVSLVKASDRENRWLRILDMQQQLAGAQIALSDEVNDSEQSTNFHNRAIAWLLYSAD
AMYCDPMEACDVYTRQCSTLLNTIELATMGATIAAGGINPVSKKRVLTESNTPFILAEMT
MEGMYGSSGDWAYTVGLPGKSGVGGGILTVVPGVMGIAAFSPPLDPVGNSVRGQKMVAAV
AQQMGYNLYRSR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgactatcgatttacaacggcttcaacaggttgcatcgaatgcctatgcgcagtattcc
acattgagtggtggcgagaatgccagctatatcccttttttagcgagcgtgccaagccat
ttagccgccttggcgattgtgaccgtcgacggggatatcatttctcagggcgatgcggag
ttccgctttgcgctggagtcaatttcaaaagtgtgctcgctagccttggcgttggaagat
gttggcccgcaagacgtacaggacaagattggtgccgatcccaccggcttgccctttaac
tcggtgattgctctggagctacataaaggtaaacccctctcgccgctggtgaatgccggg
gcaatgtcaacggtgagcttagtcaaagcgagtgaccgtgaaaaccgctggttgcgcatt
cttgatatgcaacagcagttagcgggtgcacaaatcgcactctctgacgaggtgaatgat
tcagagcaatcgaccaacttccataaccgtgcgatcgcctggttactctatagcgccgat
gcgatgtactgcgatccaatggaagcctgcgatgtttatacccgccaatgttcaacgctg
cttaataccattgaattggccacgatgggggcgacaattgccgctggtggtatcaacccc
gtcagcaaaaagcgagtgctgacagaatctaacaccccctttattttggcagaaatgacg
atggaagggatgtatggcagttcaggcgattgggcctataccgtgggtttaccgggtaaa
agtggtgttggaggcggtatcttgaccgtggtgcccggcgtaatggggattgctgcgttc
tcacctcctcttgatcccgttggtaacagcgtgcgtgggcaaaaaatggttgcggctgtt
gcccagcaaatgggatataacctttatcggagtcgttaa

DBGET integrated database retrieval system