KEGG   Sinorhizobium fredii HH103: SFHH103_00648Help
Entry
SFHH103_00648     CDS       T01731                                 

Gene name
gst5
Definition
(GenBank) gst5
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sfh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SFHH103_00648 (gst5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfh02000]
    SFHH103_00648 (gst5)
Enzymes [BR:sfh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SFHH103_00648 (gst5)
Transporters [BR:sfh02000]
 Other Transporters
  Pores ion channels [TC:1]
   SFHH103_00648 (gst5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: CCE95147
UniProt: G9A257
LinkDB All DBs
Position
726310..726939
Genome map
AA seq 209 aa AA seqDB search
MMLKLFYTPGSCSLASHIALEEAGAAHEAYRVDFSKAEQTKPEYLAINPKGRVPALVTDR
GTLTETPAILTYIAQTFPDARLAPLGDPFEFSRLQSFLSYLCSTVHVAHAHGRRGARWAD
DPAAHEAMKAKVAKNMADCFALIEDRMFAGPFVMGENYTIADPYLFTIAIWLEGDGVDPG
QFPKVLDHRNRMAERPAVAKVLEVVRARG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatgctaaaactgttttatacgccggggtcctgttcgctcgcctcgcatatcgcgctg
gaggaggcgggcgccgcccatgaggcgtatcgcgtcgacttctcaaaggccgagcagacg
aagccggaatatctggccatcaacccgaaaggccgcgttccggccctggtgaccgaccgc
ggtacgctgacggaaacgcccgctatcctcacctatattgcccagacttttccggatgcc
cgactcgcgcccctcggcgatccgttcgagttttcccggctgcagtcgttcctgagctat
ctctgctcgacggtgcacgtcgcccacgcgcatggccggcgcggtgcgcgctgggcggac
gatccggccgcccatgaggcgatgaaggcgaaggtagccaagaacatggcggattgcttc
gccctgatcgaggacaggatgtttgccggtcccttcgtgatgggcgagaattatacgatc
gccgatccctatctcttcaccattgcaatctggctcgaaggcgacggcgtcgatccgggg
cagttcccgaaagtcctcgatcaccgcaatcgcatggccgaacggcccgccgtcgccaag
gtgctggaggtcgtgcgggcgcggggttga

DBGET integrated database retrieval system