KEGG   Sinorhizobium fredii HH103: SFHH103_01059Help
Entry
SFHH103_01059     CDS       T01731                                 

Gene name
tufa1
Definition
(GenBank) elongation factor EF-Tu
  KO
K02358  elongation factor Tu
Organism
sfh  Sinorhizobium fredii HH103
Brite
KEGG Orthology (KO) [BR:sfh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sfh03012]
    SFHH103_01059 (tufa1)
   03029 Mitochondrial biogenesis [BR:sfh03029]
    SFHH103_01059 (tufa1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfh04147]
    SFHH103_01059 (tufa1)
Translation factors [BR:sfh03012]
 Eukaryotic Type
  Elongation factors
   SFHH103_01059 (tufa1)
 Prokaryotic Type
   SFHH103_01059 (tufa1)
Mitochondrial biogenesis [BR:sfh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SFHH103_01059 (tufa1)
Exosome [BR:sfh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SFHH103_01059 (tufa1)
  Exosomal proteins of breast cancer cells
   SFHH103_01059 (tufa1)
  Exosomal proteins of colorectal cancer cells
   SFHH103_01059 (tufa1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CCE95558
UniProt: G9A4S8
LinkDB All DBs
Position
1149030..1150205
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYEFPGDDIPIVKGSALAALEDSDKK
IGEDAIRELMAAVDAYIPTPERPVDLPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEI
EIVGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVDRNGVERGQVLCKPGSVKPHR
KFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaaattcgagcgcaacaagccgcacgtcaacatcggcacgattggccac
gttgaccatggcaagacgtcgctgacggcagcgatcaccaagtacttcggcgaattcaag
gcgtatgaccagatcgacgcggcgccggaagaaaaggcccgtggcatcaccatttcgacg
gcgcacgtcgaatacgagacgccggcccgccactatgcgcacgtcgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgcggcgcagatggacggcgcgatcctggtg
gtttcggctgccgacggcccgatgccgcagacccgcgagcacatcctgctggcccgccag
gtcggcgttccggcgatcgtcgtgttcttgaacaaggtcgaccaggttgacgacgccgag
cttctcgagctcgtcgagctggaagtgcgcgaacttctgtcgtcctacgaattcccgggc
gacgacattccgatcgtcaagggttcggcgctcgccgctctcgaagattcggacaagaag
atcggcgaagacgcgatccgcgagctgatggcagcggtcgacgcctacatcccgacgccg
gaacgtccggtcgacctgccgttcctgatgccgatcgaagacgtgttctcgatctccggc
cgcggtacggtcgtcaccggtcgcgtcgagcgcggcatcgtcaaggtcggtgaggaaatc
gagatcgtcggcatccgtccgacgacgaagacgacctgcacgggcgttgaaatgttccgc
aagctgctcgaccagggccaggccggcgacaacatcggtgcgctgctgcgcggtgtcgac
cgcaacggcgtcgagcgcggccaggttctgtgcaagccgggttcggtcaagccgcaccgc
aagttcaaggctgaagcctacatcctgacgaaggaagagggcggccgtcatacgccgttc
ttcaccaactaccgcccgcagttctacttccgcacgacggacgtgaccggcatcgtgacg
ctgccggaaggcaccgaaatggtgatgccgggcgataacgtaacggtcgacgtcgagctg
atcgtgccgatcgccatggaagagaagctgcgcttcgcgatccgtgaaggcggccgcacc
gtcggcgcaggcatcgtcgcctcgatcgtcgagtaa

DBGET integrated database retrieval system