KEGG   Sinorhizobium fredii HH103: SFHH103_01168Help
Entry
SFHH103_01168     CDS       T01731                                 

Gene name
pdhA
Definition
(GenBank) pyruvate dehydrogenase E1 component, alpha subunit
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00010  Glycolysis / Gluconeogenesis
sfh00020  Citrate cycle (TCA cycle)
sfh00620  Pyruvate metabolism
sfh01100  Metabolic pathways
sfh01110  Biosynthesis of secondary metabolites
sfh01120  Microbial metabolism in diverse environments
sfh01130  Biosynthesis of antibiotics
sfh01200  Carbon metabolism
Module
sfh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sfh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFHH103_01168 (pdhA)
   00020 Citrate cycle (TCA cycle)
    SFHH103_01168 (pdhA)
   00620 Pyruvate metabolism
    SFHH103_01168 (pdhA)
Enzymes [BR:sfh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     SFHH103_01168 (pdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh DXP_synthase_N TPP_enzyme_C Transketolase_N
Motif
Other DBs
NCBI-ProteinID: CCE95666
UniProt: G9A522
LinkDB All DBs
Position
1249980..1251026
Genome map
AA seq 348 aa AA seqDB search
MAPRKTASVSSRKAAAKPAKKDFAGGTIAEFSKEAELKAYREMLLIRRFEEKAGQLYGMG
FIGGFCHLYIGQEAVVVGMQLALKEGDQVITGYRDHGHMLACGMSARGVMAELTGRRGGL
SKGKGGSMHMFSKEKHFYGGHGIVGAQVSLGTGLAFANRYRGNDNVSLAYFGDGAANQGQ
VYESFNMAALWKLPVIYIVENNRYAMGTSVSRASAQTDFSQRGASFGIPGYQVDGMDVRA
VKAAADEAVEHCRSGKGPIILEMLTYRYRGHSMSDPAKYRSKDEVQKMRSEHDPIEQVKA
RLVEKGWASEDELKQVDKEVRDIVADSADFAQSDPEPDVAELYTDILL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgcgaaaaaccgcgtccgtctccagccgcaaggccgctgccaagccggccaag
aaggacttcgccggcggcacgatcgccgaattttccaaagaagctgaactgaaggcctac
cgcgaaatgctgctgatccggcgtttcgaggagaaggccggccagctttacggcatgggt
ttcatcggcggcttctgtcacctttatatcggtcaggaagctgtcgtcgtcggcatgcag
ctggcgctgaaagagggcgaccaggtcatcaccggttaccgcgatcacggccatatgctg
gcctgcggcatgagcgcccgcggcgtgatggccgaactcaccggtcgccgcggcggcctt
tccaaggggaagggcggctcgatgcacatgttctccaaggaaaagcatttttacggcggc
cacggcatcgtcggcgcgcaggtatcgctcggcacaggccttgccttcgccaacaggtat
cgcggcaacgacaatgtcagcctcgcctatttcggtgacggcgccgccaaccagggccag
gtctacgagagcttcaacatggcggcgctctggaagctgccggtgatctacatcgtcgag
aacaaccgttacgcgatgggtacctccgtgtcgcgcgcttcggcacagaccgatttttcg
cagcgcggcgcttcctttggcattccgggctatcaggtcgatggcatggacgtgcgcgcc
gtcaaggctgcggccgacgaggccgtcgaacattgccgctccggcaaggggccgatcatc
ctcgagatgctgacctaccgctaccgcggccactcgatgtccgacccggcgaaatatcgc
tcgaaggatgaagtgcagaagatgcgctcggagcatgatccgatcgagcaggtgaaggcc
cgccttgtcgaaaagggctgggcgagcgaggacgaactgaagcaggtcgacaaggaggtt
cgcgacatcgtggcggacagcgccgattttgcccagtctgatccggagccggatgtagcc
gagctctataccgacatcctgctttga

DBGET integrated database retrieval system