KEGG   Sinorhizobium fredii HH103: SFHH103_01745Help
Entry
SFHH103_01745     CDS       T01731                                 

Definition
(GenBank) UPF0721 transmembrane protein ORF9; ORF9
  KO
K07090  uncharacterized protein
Organism
sfh  Sinorhizobium fredii HH103
Brite
KEGG Orthology (KO) [BR:sfh00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SFHH103_01745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: CCE96242
UniProt: G9A7L2
LinkDB All DBs
Position
1868485..1869333
Genome map
AA seq 282 aa AA seqDB search
MLFAAASDTRRKQFPFRLEPSVTDLAFHLLLFLFVAAFIAGFIDSIAGGGGMITIPAMLI
AGIPPLETLGTNKLQSLFGSGSASIAYARHGHVNLKDQLPMALMSAAGSVFGALIATVVP
ADALKGVLPFLLIAIAVYFGCKPNIGDVEKHRRMSAFLFTLTFVPLIGLYDGIFGPGTGS
FFMLGFVSLAGYGILKATAHTKFLNFGSNLGAFLVFVLYGVVLWKVGLMMGAGQFLGAQV
GSRYAMAKGAKIIKALLVVVSIALAIRLLADPAHPLRIWLGL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
ttgcttttcgctgccgcctctgacacaaggcggaagcaatttccattccgtctcgagccg
tccgtgaccgatctcgccttccatctcctgctcttccttttcgtggcggctttcatcgcc
ggcttcatcgattcgatcgccggcggcggcgggatgatcaccattcccgccatgctgatc
gccggcatcccgccgctcgaaacgctcggcaccaacaagctgcaatcgctcttcggctcc
ggctccgccagcatcgcctatgcgcgacacggccatgtgaatctgaaggaccagttgccg
atggcgctgatgtcggccgcggggtccgtgttcggcgcattgatcgcgaccgtcgtgcca
gccgatgcgctgaagggggtactgccctttctgctgatcgcaatcgccgtctatttcggc
tgcaagccgaatatcggcgatgtcgaaaagcaccgccgcatgtcggcattcctcttcacg
ctcaccttcgtgccactgatcggcctctacgacggcattttcgggccaggtacgggctcg
ttcttcatgctcggcttcgtctcgcttgccggctacggcatcctcaaggcgacggcccac
acgaagttcctgaatttcggctccaatctcggtgccttcctcgtcttcgttctttatggc
gtcgtgctctggaaggtcgggctgatgatgggagccggccagttcctcggtgcgcaggtc
ggctcccgctacgcgatggcgaagggcgcgaagatcatcaaggcgttgctcgtcgtcgtc
tcgatcgcactggcaatccggctgctggcagacccggcgcatccgttgagaatctggctg
ggcctataa

DBGET integrated database retrieval system