KEGG   Sinorhizobium fredii HH103: SFHH103_02183Help
Entry
SFHH103_02183     CDS       T01731                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00010  Glycolysis / Gluconeogenesis
sfh00620  Pyruvate metabolism
sfh01100  Metabolic pathways
sfh01110  Biosynthesis of secondary metabolites
sfh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFHH103_02183
   00620 Pyruvate metabolism
    SFHH103_02183
Enzymes [BR:sfh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     SFHH103_02183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CCE96678
UniProt: G9A8U8
LinkDB All DBs
Position
complement(2336975..2338483)
Genome map
AA seq 502 aa AA seqDB search
MLHQKILDNPFKHKYGNFIGGEWREPVAGRYFDNTTPVTGGSLCQIARSDAADIELALDA
AHAAKEKWGRTSTTERSNILMKIAARMEDNLELLARAETWDNGKPVRETMAADIPLAIDH
FRYFAACIRAQEGTIGEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAAWKVAPALAAGNC
VVLKPAEQTPASILILAELIADLLPPGVLNIVNGFGLEAGKPLATSPRIAKIAFTGETTT
GRLIMQYASQNLIPVTLELGGKSPNIFFADVLNEDDDYFDKALEGFAMFALNQGEVCTCP
SRALVQESIYDRFMERAVKRVEAIRQGNPLDTTTMIGAQASGEQLEKILSYIDIGKQEGA
EVLTGGGRNVLEGDLSGGYYVKPTVFRGHNKMRIFQEEIFGPVVSVTTFKTEDEALEIAN
DTLYGLGAGVWSRDANRCYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMM
LDHYQQTKNMLVSYSPKALGFF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatcagaagattctcgataacccgttcaagcacaagtacggaaatttcatcggc
ggtgagtggcgcgagccggtcgccggccgctatttcgacaataccacgcctgtcaccggc
gggtcgctctgccaaattgcccgttcggatgccgccgatatcgagctcgcgctcgatgcc
gcccatgccgccaaggagaagtggggccggacctcgaccaccgagcgctccaacatcctg
atgaagatcgcggcgcggatggaggacaatctcgagcttctggcacgcgccgagacttgg
gacaacggcaagccggtccgcgagaccatggccgccgatataccgctggcaatcgatcat
ttccgctactttgccgcctgcatccgtgcgcaggaaggcacgatcggcgagatcgaccac
gataccgtcgcctatcatttccacgagccgcttggtgtcgtcggccagatcattccgtgg
aatttcccgatcctgatggccgcctggaaggtggcgccggcacttgccgccggcaactgc
gtcgtcctgaagccggccgagcagacgccggcatcgatcctcatactcgccgaattgatc
gccgacctgttgccgccgggcgtgctgaacatcgtcaacggcttcgggctcgaagcgggc
aagccgctggcgaccagcccgcgcatcgccaagatcgcctttaccggggagacgacgacg
gggcggctgatcatgcaatatgccagccagaacctcattcccgtcacactcgagctcggc
ggcaagtcgccgaacatcttcttcgccgacgtgctcaatgaggacgacgactatttcgac
aaggcgctggaaggcttcgccatgtttgcgctcaaccagggtgaggtctgcacctgcccg
agccgggcgctggtgcaggaaagcatctatgaccgcttcatggagcgggcggtgaagcgg
gtggaggcgatccggcagggcaatccgctcgacacaacaacaatgatcggcgcacaggcg
tcgggcgaacagttggagaagatcctctcctatatcgacatcggcaagcaggaaggcgcc
gaggtcctgaccggcggcgggcgcaacgtgctcgagggcgacctctcgggtggctactac
gtcaagccgacggtcttccgcgggcataacaagatgcgcatcttccaggaggagatcttc
ggcccggtcgtgtcggtgaccaccttcaagacggaggacgaggcgctcgagatcgccaat
gacacgctctacggcctcggtgccggcgtgtggagccgcgatgccaatcgctgctaccgg
ttcggccgcgagatccaggccggccgcgtctggaccaattgctaccatgcctatccggcg
catgccgccttcggcggctacaagcaatcgggcatcggccgcgagacgcacaagatgatg
ctcgaccattaccagcagacgaagaatatgctggtgagctacagcccgaaagcgctcggc
ttcttctga

DBGET integrated database retrieval system