KEGG   Sinorhizobium fredii HH103: SFHH103_02234Help
Entry
SFHH103_02234     CDS       T01731                                 

Gene name
tdk
Definition
(GenBank) tdk
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00240  Pyrimidine metabolism
sfh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SFHH103_02234 (tdk)
Enzymes [BR:sfh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SFHH103_02234 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22 KdpD
Motif
Other DBs
NCBI-ProteinID: CCE96729
UniProt: G9A8Z9
LinkDB All DBs
Position
complement(2395592..2396179)
Genome map
AA seq 195 aa AA seqDB search
MAKLYFSYATMNAGKSTLLLQAAYNYQERGMRVVMLIAAFDDRAGTGRIASRIGLKSDGI
PFHGGDDLYGLIERLNDDGSGEIACVFVDEAQFLDEDQVWQLARVADRLGIPVMAYGLRT
DFQGKLFPGSMALLALADELREVRTICHCGRKATMVVRLDGDGNVVREGAQVDVGGNEKY
VSYCRRHWEDRMRDG
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctatttcagctatgcgacgatgaatgccggcaagagcacgctgctcctg
caggccgcctacaactatcaggagcgcggcatgcgcgtcgtgatgctgatcgccgccttc
gacgatcgggctggtaccggacgaatcgcatcgcgcatcgggcttaaatcggacgggatc
ccgttccatggcggcgacgatctttacggcctcatcgaacgcctgaacgacgacggttcc
ggcgagattgcctgcgttttcgtcgacgaggcgcaattcctcgacgaggaccaggtctgg
cagctcgcgcgcgtcgccgaccgcctcggcattccggtcatggcctatggcctcagaacg
gactttcaggggaagctttttcccggctccatggctttgcttgcgctcgccgacgagctg
cgcgaggtcaggacgatctgccattgcggacgcaaggcgaccatggtcgtgcgtctcgac
ggcgacggcaatgtcgtgcgcgagggcgcgcaggtcgatgtcggcggcaatgagaaatac
gtgtcctactgccggcggcattgggaagaccggatgcgcgacggttga

DBGET integrated database retrieval system