KEGG   Sinorhizobium fredii HH103: SFHH103_03122Help
Entry
SFHH103_03122     CDS       T01731                                 

Gene name
glpD
Definition
(GenBank) glpD
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00564  Glycerophospholipid metabolism
sfh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SFHH103_03122 (glpD)
Enzymes [BR:sfh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SFHH103_03122 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8 K_oxygenase GIDA
Motif
Other DBs
NCBI-ProteinID: CCE97614
UniProt: G9A1N4
LinkDB All DBs
Position
3382510..3384027
Genome map
AA seq 505 aa AA seqDB search
MSEQAIFDVFVIGGGINGCGIARDAVGRGYSVALAEMDDFASGTSSGSTKLIHGGLRYLE
HYEFRLVREALMEREVLWAMAPHVIWPMRFVLPYHKGGPRPAWLIRLGLFLYDHIGGRKL
LPATSTLDMTRDPAGAPLKRLFTKAFEYSDGWVDDARLVVLNARDAADRGARIMARTQVV
SARRENGHWAIETEDTGTGVRETVRARLLVNATGPWVDRVLADTLGKNDVRNVRLVQGSH
IVVKKKFDDPRAYFFQNPDGRIMFAIPYQNDFTLIGTTDRDFTADPADVRISDAEVGYLC
KSASEYFSDPVTTDDIVWTYSAVRPLYDDGASKAQEATRDYVLRLEGQNGQAPLLNVFGG
KLTTYRRLAESALEKVGEAIGAKGSKWTAASRLPGGDFAASGYDAEVDKLKARYPFLTMS
HARRLVRLYGTLTSKLLGHAASEADLGKHFGADLYEVEVDWLIGQEWARRAEDVLWRRTK
LGLKLTPAAAAELEDYMRGAVNAAA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagagcaggcaatcttcgacgtctttgtcataggcggcggcatcaacggatgcggc
attgcgcgtgatgcggtcggccggggatattcggtcgcgctcgccgaaatggacgatttc
gcttcgggcacctcctccggctccaccaagctcatccatggcggcctgcggtatctcgag
cattacgaattccggctggtgcgcgaggcgctgatggagcgcgaggtgctctgggcgatg
gcgccgcacgtcatctggccgatgcgcttcgtactgccctatcacaaaggcggcccgcgg
ccggcctggctgatccgtcttgggctcttcctctacgaccatatcggcgggcgcaagctg
ttgccggcgacgagcacgctggacatgacccgcgacccggcgggcgcgccactgaagcgt
ctcttcaccaaggccttcgaatattccgacggctgggtcgacgacgcccggctggtggtg
ctgaacgcccgcgacgccgccgaccgcggcgcacggatcatggcccgcacccaggtcgtt
tcggcacggcgcgaaaacggtcactgggcgatcgaaaccgaggacaccgggaccggggta
cgcgaaaccgttcgcgcccgcctgctcgtcaacgccaccggcccctgggtcgaccgcgtg
ctcgccgatacgctcggcaagaacgatgttcgcaatgtccgcctcgtccagggcagccat
atcgtcgtgaagaagaaattcgacgatccgcgcgcctatttcttccagaatccggacggg
cggatcatgttcgccatcccttaccaaaacgatttcaccctgatcggcaccaccgaccgg
gatttcaccgccgaccccgcggacgtccgtatcagcgatgccgaggtcggctatctctgc
aaatcggcaagcgaatatttcagcgatccggtcaccacggacgatatcgtctggacctat
tcggcggtgcggccgctctatgacgacggcgccagcaaggcgcaggaggcgacccgcgac
tatgtcctgcggctcgaagggcagaacggccaggcgccgctcctcaatgtcttcggcggc
aagctgacgacttatcggcggctcgcggaatcggcactcgaaaaggtcggcgaggcgatc
ggcgccaagggcagcaagtggaccgccgcatcgcgcctgccgggcggcgactttgcggcg
tccggctatgacgccgaggtcgacaagctgaaggcgcgctacccttttctcacgatgtcg
cacgcccgccggctggtccggctctacggcacgctgacgtcaaaacttctcggacacgcc
gcaagcgaggccgatcttggaaaacatttcggcgccgatctctacgaggtcgaagtcgac
tggctgatcgggcaggaatgggcgcgccgcgccgaggacgtgctctggcgccgcacgaaa
ctgggattgaagctgacgccggcggcggccgcggaattggaggactacatgcgcggcgcc
gtcaacgccgccgcatag

DBGET integrated database retrieval system