KEGG   Sinorhizobium fredii HH103: SFHH103_05678Help
Entry
SFHH103_05678     CDS       T01731                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00250  Alanine, aspartate and glutamate metabolism
sfh00410  beta-Alanine metabolism
sfh00640  Propanoate metabolism
sfh00650  Butanoate metabolism
sfh01100  Metabolic pathways
sfh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SFHH103_05678 (gabT)
   00650 Butanoate metabolism
    SFHH103_05678 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SFHH103_05678 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SFHH103_05678 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sfh01007]
    SFHH103_05678 (gabT)
Enzymes [BR:sfh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SFHH103_05678 (gabT)
Amino acid related enzymes [BR:sfh01007]
 Aminotransferase (transaminase)
  Class III
   SFHH103_05678 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CCF00141
UniProt: G9AGF9
LinkDB All DBs
Position
pSfHH103e:882961..884229
Genome map
AA seq 422 aa AA seqDB search
MTSLTDRKNAAISRGVGMTTQIYADRAENAEIWDKEGNRYIDFAAGIAVVNTGHRHPKVI
AAVKAQLDRFTHTCHQVVPYENYVHLAERLNALAPGKFAKKTIFVTTGAEAVENAVKIAR
AATGRQAIIAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPADVFHAPFPIELHGVSVEQS
LAALKKLFAADVDPGRVAAIILEPVQGEGGFYPAPTAFMKALREICDQHGILLIADEVQT
GFARTGKLFAMEHHDVAPDLMTMAKSLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGNPI
GIAAAHAVLDVIEEEQLCERADQLGNRLKQRLAAIREKAPEITDIRGPGFMNAVEFNDVK
TNLPSAEFANKVRLIALEKGLILLTCGVHGNVIRFLAPITIQDEVFAEALDILEASILEA
RG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcctgaccgaccgcaagaacgccgccatttcccgcggtgtgggaatgaccacg
cagatctatgccgaccgtgccgaaaatgccgagatctgggacaaggagggcaatcgctat
atcgatttcgccgctggcatcgccgtcgtcaacaccggtcaccgccatccgaaggtgatc
gctgccgtcaaggcacagctcgatcgcttcacgcacacctgccaccaggtggttccctat
gagaactacgtgcatctggccgaacggctgaacgcgttggcccccggcaagttcgcgaag
aagacgatcttcgtcaccaccggcgccgaggcggtcgaaaacgccgtgaagatcgcccgc
gccgcgaccggacgccaggccatcatcgcctttggcggcggcttccacggccgcaccttc
atgggcatggcgctgaccggcaaggtcgtgccctacaaggtcggcttcggcgcaatgccg
gccgacgtcttccatgcccccttcccgatcgaactccacggcgtcagcgtcgagcagtcg
ctcgcagcgctgaagaagctgtttgccgccgacgtcgatcccggccgcgtcgcggcgatc
atcctcgagccggtccagggcgaaggcggcttctatccggcgccgaccgccttcatgaag
gcgctgcgcgagatctgcgaccagcacggcatcctgttgatcgccgacgaagtccagacc
ggctttgcccgcaccggcaagctcttcgcgatggagcatcatgatgtcgctccggacctg
atgacgatggcgaagagccttgccggcggcttcccgcttgccgcggtgaccggccgcgcc
gagatcatggacgcgccgggaccgggcggccttggcggcacatatggcggcaacccgatc
ggcatcgccgcggcgcacgccgtcctcgacgtgatcgaagaggaacaactttgcgagcgg
gccgaccagctcggcaaccgtctgaagcagcgtcttgcggcgatccgcgaaaaggcgccg
gagatcactgacatccgcggcccgggcttcatgaacgcggtcgaattcaacgatgtgaag
acaaacctgccgagcgccgaattcgccaacaaggtccgcctgatcgcgcttgaaaaaggg
ctgatcctgctgacctgcggcgtccatggcaacgtcatccgcttcctggcgccgatcacc
atccaggatgaggttttcgcggaggcgctcgatatcctcgaagcatcgatcctcgaagcg
cgcggttga

DBGET integrated database retrieval system