KEGG   Sinorhizobium fredii HH103: SFHH103_05884Help
Entry
SFHH103_05884     CDS       T01731                                 

Gene name
cbbS
Definition
(GenBank) Putative ribulose-bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00630  Glyoxylate and dicarboxylate metabolism
sfh00710  Carbon fixation in photosynthetic organisms
sfh01100  Metabolic pathways
sfh01120  Microbial metabolism in diverse environments
sfh01200  Carbon metabolism
Module
sfh_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:sfh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SFHH103_05884 (cbbS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SFHH103_05884 (cbbS)
Enzymes [BR:sfh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SFHH103_05884 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: CCF00346
UniProt: G9AH14
LinkDB All DBs
Position
pSfHH103e:1126723..1127112
Genome map
AA seq 129 aa AA seqDB search
MRITQGCFSFLPDLSDEQITAQVEYCLGKGWAIGVEYTDDPHPRNTYWEMWGNPMFDLRD
AKGVLMELEDCRKAHPQDYIRLNAFDSSRGLETVTMSFIVNRPDDEPKLRMTRTESRGRS
QHYAWETQR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcacccaaggatgcttctcgttcctgccggacctgtcggatgagcagatcacc
gcacaggtggagtattgcctcggcaagggatgggcgatcggcgtcgaatataccgacgat
ccgcacccccgcaacacctactgggaaatgtggggcaatccgatgttcgacctcagggac
gccaagggcgtcttgatggagctggaggattgccgcaaggcccacccgcaggattacatc
cgcctcaacgccttcgattccagccgtggcttggagaccgtgacgatgtccttcatcgtc
aaccgtcccgacgacgagccgaagttgcggatgacccggacggagagccgcggtcgcagc
cagcactatgcctgggaaacgcagcggtag

DBGET integrated database retrieval system