KEGG   Sinorhizobium fredii HH103: SFHH103_06561Help
Entry
SFHH103_06561     CDS       T01731                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00473  D-Alanine metabolism
sfh01100  Metabolic pathways
sfh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SFHH103_06561 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SFHH103_06561 (alr)
Enzymes [BR:sfh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SFHH103_06561 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:sfh01011]
 Precursor biosynthesis
  Racemase
   SFHH103_06561 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CCF01019
UniProt: G9AIY7
LinkDB All DBs
Position
pSfHH103e:complement(1818826..1819959)
Genome map
AA seq 377 aa AA seqDB search
MDGHALQIQSWDADASAGASGHLTIDLAALQRNYRKLSAAVAPATAAAVVKADAYGLGAE
QVSKALHAQGCRHFFVAHLLEAIKLRPLLPNDTQILVLNGLQSGAEVTCADAGVIPVLNS
LEQFRRWSSAGQKLGRVLPAVLQFDTGMSRLGVPLEERSALAAELKGCGSIEILFIMSHL
ACSDEADNRQNADQLAEMRLIAAEYAELDVCFANSGGVFLGGDYHGVLARPGIALYGGAP
TAGTPNPMEPVVWLDVAVIQTRTVPAGTRVGYGGAHVTSAETRLAIIAAGYADGLLRSLS
DRGAVFYDGVRLPIVGRVSMDSITVDITTLPEGTLSLGSLVEVLGPHQSLEDVAKAAGTI
SYEILTSLGRRYERRYR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggacggtcatgctttgcaaattcaaagttgggacgcagacgctagtgcgggtgcttca
ggccacctgaccattgatctcgccgccttacagcgaaactaccgcaagctttcggcggcg
gtcgcacctgcaacggccgccgccgtcgtcaaggccgacgcgtacgggctcggtgctgag
caggtctccaaggcgctccatgcgcagggctgccggcatttcttcgtcgcgcacctcttg
gaggcgatcaaactcagaccgctgctgccgaacgacacgcaaatattggtgctgaatgga
ttgcagtctggagcggaggtcacctgcgccgacgccggcgtcattccggtgcttaactca
ctcgagcaattccgacggtggtcgtcggcagggcagaagctcggacgcgttcttcccgcc
gtcctgcagttcgacaccggcatgtcacgtttgggggtcccactggaggaaagaagcgcg
ctggcagccgaactcaagggctgcgggagcatcgaaatcctcttcatcatgagccatctc
gcctgctccgacgaggcggacaacaggcagaatgccgatcagctcgctgagatgcgcctt
atcgccgccgagtatgcagagctcgatgtctgctttgccaattcgggcggcgtctttttg
ggcggcgactatcatggggtcctggctcgtcccggtattgccctctacggtggcgcgccc
actgccggcacacccaaccccatggagccggtcgtatggctcgacgtcgccgtcatccag
acaaggacggttcctgccggaacacgtgtgggatacggcggcgcacacgtgacctccgca
gagaccaggctcgctataatcgccgccggctatgccgacggtcttctccgcagcctcagc
gatcgcggcgccgttttctacgatggcgttcgcctgccgatcgtcgggcgcgtctcgatg
gacagcattacggtggatatcaccacccttcccgagggcacgctttccctcggcagtctt
gttgaggttctcgggccccatcagtcgcttgaggatgtcgccaaagccgccggcacgatc
tcctacgagatcctaacctccctcggccgccgctacgagcgccggtaccgctga

DBGET integrated database retrieval system