KEGG   Streptomyces fulvissimus: SFUL_1791Help
Entry
SFUL_1791         CDS       T02650                                 

Definition
(GenBank) secreted alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sfi  Streptomyces fulvissimus
Pathway
sfi00500  Starch and sucrose metabolism
sfi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SFUL_1791
Enzymes [BR:sfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SFUL_1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_20 Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-ProteinID: AGK76759
UniProt: N0CP87
LinkDB All DBs
Position
complement(2016269..2018005)
Genome map
AA seq 578 aa AA seqDB search
MARRPLSAALALVAGAAAALVIPTGFGTASPAQAAAPGDKDVTAVLFEWKFASIAKACTD
TLGPAGYGYVQVSPPQEHIQGGQWWTSYQPVSYKIAGRLGDRAAFSAMVNTCHSAGVKVV
ADSVINHMSAGNGAGTGGSSYTKYDYPGLYSVNDMNDCQAQITNYNDRGNVQNCELVGLA
DLDTGEEYVRGKIAGYLNDLLSLGVDGFRIDAAKHMPAADLANIKSRLTNPNVYWKHEAI
YGAGEAVSPSEYLGSGDVQEFRYGRSLKQVFLNENLANLKNFGEGWGFMESGKSAVFVDN
HDTERGGDTLNYKNGSAYTLANVFMLAWPYGSPDVHSGYEFSNHDAGPPGGGQVNACYAD
GWKCQHDWREVSSMVGFRNAARGQSVTNWWDNGGDQIAFGRGNKAYVAINHEGSSLTRTF
QTSLPAGDYCDVQSGRGVTVNGSGQFTATLGGGTAVALHANARTCSGGGGPNPDPGPGNG
QSGASFGVNATTQPGQNIYVTGDQAALGNWNPAGAPKLDPATYPVWKLDVNLPAGTSFAY
KYVRKDGQGNVTWESGANRTATVPSSGKVTLTADVWRS
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcagacccctgtctgccgcgctcgccctcgtggccggcgccgctgccgccctt
gtcatccccaccggattcggcaccgcgtcccccgcgcaggccgccgctccgggcgacaag
gacgtcaccgccgtgctgttcgagtggaagttcgcctccatagccaaggcctgcacggac
acactcggtccggcaggctacggctacgtccaggtctcgccgccccaggagcacatccag
ggcggccagtggtggacgtcgtaccagcccgtcagctacaagatcgccggtcgcctcggt
gaccgggccgcgttctccgccatggtcaacacgtgtcactcggccggggtcaaggtcgtc
gccgactccgtcatcaaccacatgtcggcaggcaacggcgcgggcaccggcggctcgtcg
tacacgaagtacgactatccgggcctctactccgtgaacgacatgaacgactgccaggcg
cagatcaccaactacaacgaccgcggcaacgtccagaactgtgaactggtcggcctcgcc
gacctggacacgggcgaggagtacgtacgcggcaagatcgccggctacctcaacgacctg
ctctccctcggggtcgacggcttccggatcgacgcggccaagcacatgccggccgccgac
ctcgccaacatcaagtcccggctgaccaacccgaacgtctactggaagcacgaggcgatc
tacggggcgggcgaggcggtctcgccctccgagtacctcggctccggtgacgtccaggag
ttccggtacgggcgcagcctcaagcaggtcttcctcaacgagaacctcgccaacctgaag
aacttcggcgagggctggggcttcatggagtccgggaagtccgccgtcttcgtcgacaac
cacgacaccgagcgtggcggcgacaccctcaactacaagaacggctccgcctacaccctc
gccaacgtcttcatgctggcctggccctacggctccccggacgtccactccggctacgag
ttcagcaaccacgacgccggaccgccgggcggcggccaggtgaacgcctgctacgccgac
ggctggaagtgccagcacgactggcgcgaggtctcctccatggtcggcttccgcaacgcc
gcacgcggccagtccgtcaccaactggtgggacaacggcggcgaccagatcgccttcggc
cggggaaacaaggcgtacgtggccatcaaccacgaagggtcctcgctgacccggaccttc
cagacctcgctgcccgccggtgactactgcgacgtgcagagcgggcggggcgtcacggtg
aacggctccggccagttcaccgccacgctcggcggaggtacggcggtggccctgcacgcg
aacgcccgtacgtgctccggaggcggcggcccgaaccccgacccgggtccgggcaacgga
cagtccggcgcctccttcggcgtcaacgccaccacccagcccggccagaacatctacgtc
accggtgaccaggccgccctcggcaactggaacccggccggcgcgccgaagctcgacccg
gccacgtaccccgtctggaagctggacgtgaacctgcccgccgggacctcgttcgcgtac
aagtacgtccgcaaggacggacaaggcaacgtcacctgggagagcggcgccaaccgcacc
gccactgtcccgtcctccggaaaggtcacgctgaccgccgacgtctggcgcagctga

DBGET integrated database retrieval system