KEGG   Streptomyces fulvissimus: SFUL_2576Help
Entry
SFUL_2576         CDS       T02650                                 

Definition
(GenBank) Serine/threonine protein kinase pkaA
Organism
sfi  Streptomyces fulvissimus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Kinase-like PhoR Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AGK77524
UniProt: N0CRM1
LinkDB All DBs
Position
complement(2909606..2911276)
Genome map
AA seq 556 aa AA seqDB search
MRPVGSKYLLEEPLGRGATGTVWRARQRETAGAEAAVAGQPGETVAIKVLKEELANDADV
VMRFLRERSVLLRLTHPNIVRTRDLVVEGDLLALVMDLIDGPDLHRYLRENGPLTPVAAS
LLTAQIADALAASHADGVVHRDLKPANVLLDERDGRMTPMLTDFGIARLADSPGLTRTHE
FVGTPAYVAPESAEGRPQTSAVDIYGAGILLYELVTGRPPFAGGTALEVLHRHLSEEPRR
PSTVPEPLWTVIERCLSKDPDRRPSAENLARGLRTVAAGIGVHANSAQIAAADGVGALLA
PDPAPTAVPETPGAADPTQVLPSNAGSYDPAAATSVLQQTSGPGGGQGSGGHADPTAVMP
PVPQRPDGPPQPDGPHPWQSQLQAARDRNEQTQVQYLEPSQDPLRRRPQRQAPQQPPQRQ
QPPQHRQQPLQQQYPPQHQQQQQHQPQRYQAPPQPQRQQYAPPQPQQPAPREPRPPRQRS
SNPMRIPGLGCLKGCLFTVVLLVIAGWLIWELTPLQDWVAQGKGYWEAIGDAIGTVTDWV
SKIGETTGESGGTGGA
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
gtgcggccggtaggcagcaagtacctgctcgaggaaccgctcggacgcggcgccacgggc
accgtctggcgagcccgccagcgggagaccgcgggcgccgaggcggccgtcgccggtcag
cccggcgagaccgtggcgatcaaggtcctcaaggaggagctcgccaacgacgccgatgtg
gtgatgcggttcctgcgggagcgctcggtcctgttgcggctcacgcacccgaacatcgtg
cgcacccgtgacctggtggtcgagggcgatctcctcgccctggtgatggacctgatcgac
ggtcccgacctccaccgctacctgcgcgagaacggcccgctcaccccggtcgccgcgtcc
ctgctcaccgcgcagatcgccgacgcgctcgccgccagccacgcggacggcgtcgtccac
cgcgacctcaagccggccaacgtgctgctcgacgagcgcgacggccggatgaccccgatg
ctcaccgacttcggcatcgcgcgcctcgccgactccccggggctgacccggacgcacgag
ttcgtcggcacccccgcctatgtggcgccggagtccgccgagggccgcccgcagacctcc
gccgtggacatctacggcgcgggcatcctgctgtacgagctggtcaccggccgcccgccg
ttcgccgggggcaccgccctcgaagtcctgcaccggcacctcagcgaggagccccgccgc
ccctccaccgtgcccgaaccgctgtggacggtcatagagcgctgcctgagcaaggacccg
gaccggcggccgagcgccgagaacctggcccgcggcctgcgtacggtcgccgccggcatc
ggcgtccacgcgaactcggcccagatcgccgccgccgacggagtgggcgcactgctcgcc
ccggacccggcgcccacggccgtcccggagacccccggcgccgccgaccccacacaggtg
ctgccgagcaacgcgggctcgtacgaccccgcagccgccaccagcgtgctccagcagacc
tcgggcccgggcggcggccagggatccggcggccacgccgacccgaccgccgtcatgccg
cccgtaccgcagcgccccgacgggccgccgcagccggacggcccgcacccctggcagtcg
cagctccaggcggcccgcgaccgcaacgagcagacgcaggtgcagtacctggaaccgagc
caggacccgctgcgccgccgcccccagcgccaggcgccccagcagcctccccagcgacag
cagccgccgcagcaccggcagcagccgctccagcagcagtacccgccgcaacaccagcag
caacagcagcaccagccccagcgctaccaggcgccgccgcagccccagcggcagcagtac
gcgcctccgcagccgcagcagcccgccccgcgcgagccgcgcccgccgaggcagcgcagc
tccaacccgatgcgcatccccggtctcggctgcctcaagggctgcctgttcaccgtggtg
ctgctggtcatcgccggctggctgatctgggagctcaccccgctccaggactgggtcgcc
cagggcaagggctactgggaagcgatcggcgacgcgatcgggacggtcaccgactgggtc
tccaagatcggcgagacaaccggcgaatccggcggcacgggcggagcctga

DBGET integrated database retrieval system