KEGG   Streptomyces fulvissimus: SFUL_6246Help
Entry
SFUL_6246         CDS       T02650                                 

Definition
(GenBank) Aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sfi  Streptomyces fulvissimus
Pathway
sfi00250  Alanine, aspartate and glutamate metabolism
sfi00410  beta-Alanine metabolism
sfi00640  Propanoate metabolism
sfi00650  Butanoate metabolism
sfi01100  Metabolic pathways
sfi01120  Microbial metabolism in diverse environments
Module
sfi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sfi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SFUL_6246
   00650 Butanoate metabolism
    SFUL_6246
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SFUL_6246
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SFUL_6246
Enzymes [BR:sfi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SFUL_6246
Amino acid related enzymes [BR:sfi01007]
 Aminotransferase (transaminase)
  Class III
   SFUL_6246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGK81129
UniProt: N0D1T0
LinkDB All DBs
Position
7001430..7002713
Genome map
AA seq 427 aa AA seqDB search
MSGLYERHLAVSPEWLALYYRHPIELTHGEGRYVWDADGNRYLDFFGGILTTMTAHALPE
VTKAIAEQAGRIIHSSTLYLNRPMVELAERIATLSGIPDARVFFTTSGTEANDTALLLAT
AYRRSNQILAMRNSYHGRSFSAVSITGNHAWSPTTLSPLQTLYVHGGVRTRGPYAELSDA
QFIRACVADLEDLLGHTREAAALIAEPIQGVGGFTSPPDGLFAAFREVLDRHGILWISDE
VQTGWGRTGEHFWGWQAHAEHGPPDILTFAKGIGNGMSIGGVVARAEVMNCLDANSISTF
GGSPVTMAAGLANLSYHLEHDLQGNARRVGGLLIERLRGIAAGSAAVREVRGRGLMIGIE
LVKPGTDEAHPEAAAAVLEAARAGGLLIGKGGGHNTSVLRIAPPLTLTVAEAEEGASVLA
DALRAAD
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgggctgtacgagcgccacctcgccgtcagccccgagtggctggcgctctactac
cgccaccccatcgaactcacccatggcgagggccggtacgtctgggacgccgacggcaac
cgctacctcgacttcttcggcggcatcctcaccacgatgaccgcccacgccctgcccgag
gtcaccaaggcgatcgccgagcaggccggccggatcatccactcctccacgctctacctc
aaccgccccatggtggagctggccgagcggatcgccaccctctccggcatccccgacgcc
cgggtcttcttcaccacgtcgggcaccgaggccaacgacaccgcgctgctgctcgccacc
gcgtaccgcaggtccaaccagatcctcgcgatgcgcaacagctaccacggccgctccttc
tcggccgtctccatcaccggcaaccacgcctggtcgcccacgaccctctccccactgcag
acgctgtacgtccacgggggcgtccgcacccgggggccgtacgcggagctgagcgacgca
cagttcatccgggcgtgcgtcgccgatctggaggacctcctcgggcacacccgggaggcc
gcggcgctcatcgcggaacccatccagggcgtcggcggcttcacctcgccgcccgacgga
ctgttcgccgcgttccgcgaagtcctggaccgccacggcatcctgtggatctccgacgag
gtgcagaccggctggggacgtaccggcgaacacttctggggctggcaggcgcacgccgag
cacgggccgccggacatcctcaccttcgccaagggcatcggcaacggcatgtccatcggc
ggagtcgtcgcccgcgcggaggtgatgaactgcctggacgccaactccatctccacgttc
ggcggttcacccgtcacgatggccgccggcctcgccaacctctcgtaccacctggagcac
gacctccagggcaacgcgcggcgcgtcggcgggctcctcatcgaacggctgcgcgggatc
gccgcagggtccgccgccgtacgcgaagtgcgcggccggggcctgatgatcggcatcgag
ctggtgaaacccggcacggacgaggcccacccggaggcggccgcggccgtcctcgaagcg
gcacgcgcgggcggactgctcatcggcaagggcggcggccacaacaccagcgtgctgcgg
atcgccccgcccctgaccctgaccgtcgccgaggccgaggagggcgcgtcggtcctcgcc
gacgccctgcgcgccgccgactga

DBGET integrated database retrieval system