KEGG   Serratia ficaria: SAMEA4384070_2286Help
Entry
SAMEA4384070_2286 CDS       T06444                                 

Gene name
gstA
Definition
(GenBank) Glutathione S-transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sfj  Serratia ficaria
Pathway
sfj00480  Glutathione metabolism
sfj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SAMEA4384070_2286 (gstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfj02000]
    SAMEA4384070_2286 (gstA)
Enzymes [BR:sfj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SAMEA4384070_2286 (gstA)
Transporters [BR:sfj02000]
 Other transporters
  Pores ion channels [TC:1]
   SAMEA4384070_2286 (gstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_C_3 GST_N_2 GST_C_2 Glutaredoxin2_C GST_C_6
Motif
Other DBs
NCBI-ProteinID: SNW00971
UniProt: A0A240BYN8
LinkDB All DBs
Position
1:complement(2405695..2406300)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKAGACSLSPHIVLREAGLDFTAEKVDLAQKKTESGADYLSINPKGQVPALVLDDG
SLLTEGVAIVQYLADRVPDRNLIPAAGTLSRYHAIEWLNYIATELHKGFSPLFNPKTPDE
YKAIARARLEQQFSYLDSVLARQHFLLGSRFSVADAYLFTVLRWAIALQFDIRQHAHLAA
WFDSVAARPAVEAALSAEGLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctataaagccggcgcctgttcgctctccccgcacatcgtgctgcgcgag
gccggcctggattttacggcggaaaaggtcgatttggcgcaaaagaaaaccgaaagcggt
gcggattacctgagcatcaaccccaaaggacaggtgcctgcgctggtgcttgatgacggc
agcctgctgaccgaaggcgtggctattgtgcaatacctggccgaccgcgtgccggatcgc
aacctgatcccggcggccggcaccctgtcgcgctaccatgcgatcgaatggctgaactac
atcgccaccgagttgcacaagggattcagcccgctgttcaaccccaaaacgccggatgag
tacaaggccatcgcgcgcgccaggcttgagcagcagttcagctacctggattcggtgttg
gccaggcagcactttctgttggggagccgtttcagcgtagcggacgcctatctgtttacc
gtgctgcgctgggcgatcgccctgcagtttgatatccgacagcatgcccatctggcggcc
tggttcgacagcgtcgcggcgcgcccggcggtggaagcggcgctgagcgccgaaggactg
aaataa

DBGET integrated database retrieval system