KEGG   Serratia ficaria: SAMEA4384070_3031
Entry
SAMEA4384070_3031 CDS       T06444                                 

Definition
(GenBank) Protein of avirulence locus involved in temperature-dependent protein secretion
  KO
K11898  type VI secretion system protein ImpE
Organism
sfj  Serratia ficaria
Brite
KEGG Orthology (KO) [BR:sfj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sfj02044]
    SAMEA4384070_3031
Secretion system [BR:sfj02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   SAMEA4384070_3031
SSDB
Motif
Pfam: ImpE TPR_19
Other DBs
NCBI-ProteinID: SNW02918
UniProt: A0A240C762
LinkDB
Position
1:3198668..3199489
AA seq 273 aa
MKSLASMLQGGSVSAAIGAVESEIKARPADADLRAALVQLLCLSGNWQRANAQLKSWQAL
KPIAQPTTLLLMQSVSAELQRQAVFAGEAAPALLQQNQPWLQQMIQALDHDARGEAEQAQ
ALRDSALDAAPASAGRLTLAQGEQEQPVAFEWLTDGDGRLGPVCELALNGVYYWLPFADI
AEIQFQAPQSAIDLVWSHALVRLHDGREQVCQLPARYPLAADSDDALLLGKRTEWLPLGD
GPHYAGQGLKTWLSESEEFPLHSLRHLSFGADA
NT seq 822 nt   +upstreamnt  +downstreamnt
gtgaaatcattagcaagcatgctgcaaggcggttcggtcagcgcggccatcggcgccgtg
gaaagtgaaatcaaggcgcgcccggcggatgccgacctgcgcgccgcgctggtgcagctg
ctgtgcctgagcggcaactggcagcgcgccaatgcgcagctgaagtcgtggcaggcgctg
aagccgatcgctcagcccaccaccctgctgctgatgcagtcggtcagcgcggagctgcag
cgccaggcggtattcgccggcgaggccgcgccggcgctgctgcagcagaatcagccctgg
ctgcagcagatgatccaggcgctggaccacgacgcgcgaggagaggccgaacaggcgcag
gcgctgcgcgacagcgcgttggacgccgcaccggccagcgccgggcggctgacactggct
cagggcgaacaggagcagccggtggccttcgaatggctgaccgacggcgacggccgcctt
ggcccggtgtgcgagctggcgctgaacggcgtctattactggctgccgttcgccgatatc
gccgaaattcaattccaggcgccgcaaagcgccatcgatctggtgtggagccatgcgctg
gtacgcctgcatgacggccgcgaacaggtatgccagctgcccgcccgctacccgctggcc
gcagacagcgacgacgccctgctgctcggcaagcgcaccgaatggctgccgctgggcgac
ggcccgcactacgccggccaggggctgaaaacctggctgagcgagagcgaagaatttccg
ttgcacagcctgcgccatctgagctttggcgcggacgcctga

DBGET integrated database retrieval system