KEGG   Streptomyces formicae: KY5_2391cHelp
Entry
KY5_2391c         CDS       T05416                                 

Definition
(GenBank) Aldehyde dehydrogenase
Organism
sfk  Streptomyces formicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh TruB_C
Motif
Other DBs
NCBI-ProteinID: ATL27409
UniProt: A0A291Q6S0
LinkDB All DBs
Position
complement(2846756..2848222)
Genome map
AA seq 488 aa AA seqDB search
MTELVEHGQLFIGGELVDPLGKGVIDVVSPHTGKVFARVPHAAPADVDRAVATARKAFDD
GPWRRMTLDERIEVVTKIKDGIAVRHEEIARAISSENGTPYTSSVMVQALAAMMAWDAAI
TVARDFTYEEARDGVLGKLLVRREPVGVVAAVVPWNVPQFTAAAKLAPALLAGCPVILKT
SPEAPLDAYILAEIAAEAGLPQGVLSVISADREVSEYLVAHPGVDKVSFTGSVAAGKRVM
EVAARNLTRVTLELGGKSAAVILPDADAATAVAGITPFAWMINGQACVAQTRILVPRTRY
DEFAEAFAAAASALKVGDPLDPATELGPLVAKRQQQRSLDYIRIGQEEGAKILAGGGRPA
GLDQGWYVEPTLLGGVDNSMRVAREEIFGPVICLLPYGEQDEAVKIANDSDYGLSGSVWT
ADVERGIDVARQVRTGTYSVNTFSLDMLGPFGGFKNSGLGREFGPEGYAEYFEHQMIHLP
AGYEGSGA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagctcgtggaacacggacagctgttcatcggcggggagttggtggacccgctc
ggcaagggcgtcatcgacgtcgtgtcgccgcacaccggaaaggtcttcgcccgcgtgccg
cacgcggcccccgccgacgtggaccgcgccgtcgccaccgcccgcaaggcgttcgacgac
gggccctggcgccgcatgaccctggacgagcggatcgaggtcgtcaccaagatcaaggac
gggatcgccgtacgccacgaggagatcgcccgcgccatcagctcggagaacggcaccccg
tacacctccagcgtgatggtgcaggcgctcgccgcgatgatggcgtgggacgcggccatc
acggtggcccgcgacttcacctacgaggaggcacgcgacggcgtcctcgggaaactcctc
gtgcggcgcgagccggtgggggtggtcgcggccgtcgtcccctggaacgtcccgcagttc
accgccgcggccaagctcgcccccgcgctgctcgccgggtgcccggtgatcctcaagacc
tcgcccgaggcacccctggacgcctacatcctggccgagatagccgcagaggccgggctg
ccgcagggcgtcctctccgtcatctccgcggaccgcgaggtcagcgagtacctcgtcgcg
caccccggcgtcgacaaggtctccttcaccggatccgtcgcggcgggcaagcgcgtcatg
gaggtcgcggcccgcaacctcacccgggtcaccctggagctcggcggcaagtccgccgcg
gtcatcctgccggacgccgacgcggccaccgccgtcgcgggcatcacccccttcgcctgg
atgatcaacggccaggcgtgcgtggcccagacccgcatcctcgtgccgcgcacccgctac
gacgagttcgccgaggcgttcgccgccgccgcgtccgccctcaaggtcggcgaccccctc
gaccccgccaccgagctgggcccgctcgtcgccaagaggcagcagcagcgctccctggac
tacatccgcatcggccaggaggagggcgccaagatcctcgcgggcggcggccgcccggcc
gggctcgatcaggggtggtacgtcgagccgacgctcctgggcggcgtcgacaactccatg
cgcgtcgcccgcgaggagatcttcggccccgtcatctgcctcctgccgtacggcgaacag
gacgaggcggtgaagatcgccaacgactccgactacgggctcagcggcagcgtgtggacg
gccgacgtcgagcgcggcatcgacgtcgcacggcaggtgcgcaccgggacgtactccgtg
aacaccttcagcctcgacatgctcgggcccttcgggggcttcaagaactccggtctgggg
cgggagttcgggcccgaggggtacgccgagtacttcgagcaccagatgatccacctcccc
gccggatacgaggggagtggcgcctga

DBGET integrated database retrieval system