KEGG   Streptomyces formicae: KY5_2447Help
Entry
KY5_2447          CDS       T05416                                 

Definition
(GenBank) Pyruvate dehydrogenase E1 component
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
sfk  Streptomyces formicae
Pathway
sfk00010  Glycolysis / Gluconeogenesis
sfk00020  Citrate cycle (TCA cycle)
sfk00620  Pyruvate metabolism
sfk01100  Metabolic pathways
sfk01110  Biosynthesis of secondary metabolites
sfk01120  Microbial metabolism in diverse environments
sfk01130  Biosynthesis of antibiotics
sfk01200  Carbon metabolism
Module
sfk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sfk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KY5_2447
   00020 Citrate cycle (TCA cycle)
    KY5_2447
   00620 Pyruvate metabolism
    KY5_2447
Enzymes [BR:sfk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     KY5_2447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH_E1_M Transketolase_N
Motif
Other DBs
NCBI-ProteinID: ATL27465
UniProt: A0A291Q7I9
LinkDB All DBs
Position
2904411..2907143
Genome map
AA seq 910 aa AA seqDB search
MASGSDRNPIIIGGLPSQVPDFDPEETQEWLDSLDAAVDERGRERARYLMLRLIERAREK
RVAVPEMRSTDYVNTIATKDEPFFPGNEEIERKVLNATRWNAAVMVSRAQRPGIGVGGHI
ATFASSASLYDVGFNHFFRGKDEGDGGDQIFFQGHASPGIYARAFLLDRLSEQQLDAFRQ
EKSKAPNGLSSYPHPRLMPDFWEFPTVSMGLGPLGAIFQARMNRYMEARDIADTSKSHVW
AFLGDGEMDEPESLGQLSIAAREGLDNLTFVVNCNLQRLDGPVRGNGKIIQELESQFRGA
GWNVIKLVWDRSWDPLLAQDRDGLLVNKLNTTPDGQFQTYATETGAYIRDHFFGDDQRLR
AMVEGMTDEQILHLGRGGHDHKKVYAAFSAAKAHKGQPTVILAQTVKGWTLGPNFEGRNA
THQMKKLTVDDLKGFRDRLHIPITDKQLEDGAPPYYHPGRDSEEIQYMHDRRKSLGGYVP
TRVVRSKPLQLPEDKTYATAKKGSGQQSIATTMAFVRILKDLMRDKEIGKRFVLIAPDEY
RTFGMDAFFPSAKIYNPLGQQYEAVDRDLLLAYKESPTGQMLHDGISEAGCTASLIAAGS
AYATHGEPLIPVYVFYSMFGFQRTGDQFWQMADQLARGFVLGATAGRTTLTGEGLQHADG
HSQLLASTNPGCVAYDPAFGYEIAHIVKDGLRRMYGPDSEDVFYYLTVYNEPIQHPAEPA
DVDVDGILKGIYRFKSGEQGAISAQILASGVAVPWAVEAQQILASEWNVKADVWSATSWN
ELRREAVDVERHNLLHPEEEQRVPYVTRKLSGSEGPFVAVSDWMRSVPDQISRWVPGTYQ
SLGADGFGFADTRGAARRYFHIDAQSIVVGVLTELAREGKVDRSVLKQAIDRYQLLDVTA
ADPGAAGGDA
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
gtggcttccggctccgatcgcaacccgatcatcattggcggcctgccgagtcaggtcccg
gacttcgaccccgaagagacccaggagtggctcgactccctcgatgccgcggtcgacgaa
cgcggccgtgaacgggcccgctacctgatgctccggctgatcgagcgcgcgcgggagaag
cgcgtcgccgtgccggagatgcgcagcaccgactacgtcaacacgatcgccaccaaggac
gagccgttcttccccggaaacgaggagatcgagcgcaaggtcctgaacgcgacccgctgg
aacgccgcggtgatggtctcccgcgcccagcgccccggcatcggggtcggcggtcacatc
gccaccttcgcctcctccgcctcgctctacgacgtgggcttcaaccacttcttccggggc
aaggacgagggcgacggcggcgaccagatcttcttccaggggcacgcgtcccccggcatc
tacgcccgcgccttcctcctcgaccggctctccgagcagcagctcgacgcgttccggcag
gagaagtccaaggcgcccaacggcctttcgtcgtacccgcatccgcggctgatgccggac
ttctgggagttcccgaccgtctccatgggcctcggaccgctcggcgcgatcttccaggcg
cggatgaaccgctacatggaggcgcgcgacatcgccgacacctccaagtcgcacgtctgg
gcgttcctcggtgacggcgagatggacgagcccgagtcgctcggccagctctccatcgcc
gcccgtgagggcctggacaacctcaccttcgtcgtcaactgcaacctgcagcgcctggac
ggcccggtgcgcggcaacggcaagatcatccaggagctggagtcgcagttccgcggcgcc
ggctggaacgtcatcaagctggtctgggaccgcagttgggacccgctgctcgcgcaggac
cgcgacggcctcctggtgaacaagctgaacaccacgcccgacggccagttccagacctac
gccacggagaccggcgcgtacatccgcgaccacttcttcggagacgaccagcgcctgcgc
gccatggtcgagggcatgaccgacgagcagatcctgcacctgggccgcggcggccacgac
cacaagaaggtctacgcggcgttctcggcggccaaggcccacaagggccagccgaccgtg
atcctcgcccagacggtcaagggctggaccctcggcccgaacttcgagggccgcaacgcc
acgcaccagatgaagaagctgacggtcgacgacctcaagggcttccgcgaccgtctgcac
atcccgatcacggacaagcagctggaggacggcgccccgccgtactaccacccgggccgc
gactccgaagagatccagtacatgcacgaccgccgcaagagcctcggcggctacgtcccg
acccgcgtggtgcgctcgaagccgctccagttgcccgaggacaagacgtacgcgaccgcg
aagaagggttcgggccagcagtcgatcgccaccacgatggcgttcgtccgcatcctgaag
gacctcatgcgggacaaggagatcggcaagcgcttcgtgctgatcgcccccgacgagtac
cgcaccttcggcatggacgcgttcttcccgagcgcgaagatctacaacccgctcggccag
cagtacgaggccgtggaccgcgatctgctcctcgcctacaaggagtcgccgacgggccag
atgctgcacgacggcatctcggaagcgggctgcacggcgtccctcatcgccgcgggttcg
gcctacgccacccacggcgagccgctgatccccgtgtacgtcttctactcgatgttcggt
ttccagcgcaccggcgaccagttctggcagatggccgaccagctggcgcgcggtttcgtc
ctcggcgcgaccgcggggcgcacgaccctgaccggcgagggcctgcagcacgcggacggg
cactcgcagctgctcgcctcgaccaacccggggtgtgtcgcctacgaccccgccttcggc
tacgagatcgcgcacatcgtcaaggacggcctgcgccggatgtacggccccgacagtgag
gacgtcttctactacctcaccgtctacaacgagccgatccagcacccggccgagcccgcc
gacgtggacgtcgacggcatcctcaagggcatctaccgcttcaagtccggtgagcagggc
gccatttcggcccagatcctggcctccggcgtggcggtgccgtgggcggtcgaggcgcag
cagatcctcgcgtcggagtggaacgtcaaggcggacgtctggtcggcgacctcctggaac
gaactgcgccgcgaggccgtcgacgtggagcgccacaacctcctgcaccccgaggaggag
cagcgcgtcccgtacgtcacgcgcaagctgtccggctccgagggtccgttcgtggccgtc
tccgactggatgcggagcgtccccgaccagatctcccgctgggtgcccggcacgtaccag
tcgctcggcgcggacggcttcggcttcgccgacacgcgtggcgcggcccggcgctacttc
cacatcgacgcgcagtcgatcgtggtcggcgtgctgaccgaactggcccgcgagggcaag
gtcgaccgctccgtcctgaagcaggcgatcgaccgctaccagctcctcgacgtcacggcc
gccgacccgggcgccgccgggggcgacgcgtag

DBGET integrated database retrieval system