KEGG   Streptomyces formicae: KY5_6702Help
Entry
KY5_6702          CDS       T05416                                 

Definition
(GenBank) putative aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sfk  Streptomyces formicae
Pathway
sfk00250  Alanine, aspartate and glutamate metabolism
sfk00410  beta-Alanine metabolism
sfk00640  Propanoate metabolism
sfk00650  Butanoate metabolism
sfk01100  Metabolic pathways
sfk01120  Microbial metabolism in diverse environments
Module
sfk_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sfk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    KY5_6702
   00650 Butanoate metabolism
    KY5_6702
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KY5_6702
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KY5_6702
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sfk01007]
    KY5_6702
Enzymes [BR:sfk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     KY5_6702
Amino acid related enzymes [BR:sfk01007]
 Aminotransferase (transaminase)
  Class III
   KY5_6702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DUF442 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ATL31720
UniProt: A0A291QIU6
LinkDB All DBs
Position
7801332..7802621
Genome map
AA seq 429 aa AA seqDB search
MTDLYDRHRAVLPDWLALYYSRPLELTHGEGRHVWDAEGNRYLDFFGGILSTLTAHALPE
VTKAVADQAGRIIHTSTLYLNRPMVDLAERVAALSGIPDARVFFTTSGTEANDTALMLAT
AYRGSNQVLAMRNSYHGRSFTAVGITGNRAWSPTSLSPLQTLYVHGGVRSRGPYAALSDA
EFIEACVADLRDVLGQARGGVAALIAEPIQGVGGFTSPPDGLYAAFREVLDEQGILWISD
EVQTGLGRTGEHFWGWQAHARSGPPDVLTFAKGIGNGMSIGGVVARAELMNCLDANSIST
FGGSPVTMAAGLANLTHLLEHDLQGNARRVGGLLIERLRAICAQLPGVREVRGRGLMIGI
ELVRPGTDEPDQDAAAAVQEAARDGGLLIGKGGGHHTSVLRVAPPLSLTVAEAEEGAAIL
ERALRSVQS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgatctgtacgaccgccaccgggcggtgctgcccgactggctcgcgctgtactac
agccgtccgctcgaactcacccacggcgagggccggcacgtctgggacgccgagggcaac
cggtacctcgacttcttcggcggcatcctctccaccctcaccgcgcacgccctgcccgag
gtcaccaaggccgtcgcggaccaggcagggcggatcatccacacctcgacgctgtacctc
aaccgcccgatggtggacctcgccgaacgggtcgccgcgctctccgggatccccgacgcc
cgggtcttcttcaccacgtcgggcaccgaggccaacgacaccgccctgatgctcgccacc
gcgtaccggggctccaaccaggtcctggcgatgcgcaacagctaccacggccgctccttc
acggccgtcggcatcaccggcaaccgcgcctggtcgccgaccagcctctcgcccctccag
acgctgtacgtgcacgggggcgtgcgcagccggggcccgtacgccgccctgagcgacgcc
gagttcatcgaagcgtgcgtcgccgacctgcgggacgtgctcgggcaggcgcgaggggga
gtggcggccctgatcgccgagcccatccagggcgtgggcggcttcacctcgccgcccgac
ggtctgtacgccgcgttccgcgaggtcctcgacgagcagggcatcctgtggatctccgac
gaggtgcagaccggactcgggcgtacgggcgagcacttctggggctggcaggcgcacgcc
cggagcggcccgccggacgtcctcaccttcgccaagggcatcggcaacggcatgtcgatc
ggcggcgtcgtggcccgcgccgagctcatgaactgcctcgacgccaactccatctcgacg
ttcggcggctcgccggtcaccatggcggcgggcctcgcgaacctcacgcacctcctggaa
cacgacctccagggcaacgcacggcgcgtcggcggactgctcatcgagcggctgcgggcg
atctgcgcccaactgcccggcgtgcgcgaggtgcgcgggcgcggcctgatgatcggcatc
gagctggtgcggccgggcacggacgagccggaccaggatgcggcggccgccgtccaggag
gcggcccgcgacggcggactgctcatcggcaagggaggcggccaccacaccagcgtgctg
cgcgtggcgccgccgctctcgctgaccgtcgcggaggcggaggaaggcgcagccatcctc
gaacgggccctgcggagcgtccagtcgtag

DBGET integrated database retrieval system