KEGG   Streptomyces formicae: KY5_6732
Entry
KY5_6732          CDS       T05416                                 

Definition
(GenBank) 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
sfk  Streptomyces formicae
Pathway
sfk00997  Biosynthesis of various secondary metabolites - part 3
sfk01100  Metabolic pathways
sfk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfk00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    KY5_6732
Enzymes [BR:sfk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     KY5_6732
SSDB
Motif
Pfam: DeoC NMO
Other DBs
NCBI-ProteinID: ATL31750
UniProt: A0A291QIX5
LinkDB
Position
7837591..7838424
AA seq 277 aa
MTAARTRFGGKELRMSRLSRRADERYLFIPLDHSVSDGPVADAVEFDRLLGRIVAGGADA
VIVHKGRAPRIDPRHLRSCALIVHLSAGTVHAADENAKVLVGGVEDAVRLGADAVSVHVN
VGSETEAAQLADLGRIATECQHWNLPLLAMIYPRGPRIADACDPGLLSHVVNIAVDLGAD
LVKTSAAAPLHRMAEVVASCPVPVLVAGGPENGADLSGYARAVLDAGCAGLAVGRRVFTS
ADPERLVRDLAETVHAPRDLTDLPSPVAGLYDTVATL
NT seq 834 nt   +upstreamnt  +downstreamnt
gtgaccgccgcccgcacccgcttcggcgggaaagagctccgtatgagcaggctctcgcga
agggccgacgaacgctatctgttcattccgcttgaccactccgtctccgacgggccggtc
gccgacgccgtcgagttcgaccggctgctcggccggatcgtggcgggcggcgcggacgcc
gtgatcgtgcacaagggccgtgcccccaggatcgacccgcgccatctgcgctcctgcgcg
ctgatcgtgcacctcagcgcgggcacggtgcacgccgccgacgagaacgccaaggtgctc
gtcggcggcgtggaggacgcggtgcggctcggcgccgacgcggtcagcgtgcacgtcaac
gtgggatcggagaccgaggcggcgcagctcgccgacctcggccgcatcgccaccgagtgc
cagcactggaacctgccactgctcgcgatgatctaccccaggggccccaggatcgccgac
gcctgcgaccccggcctgctctcgcacgtggtgaacatcgccgtcgacctgggcgccgac
ctggtcaagacctcggccgccgcgccgctgcaccggatggcggaggtcgtggcgagctgc
ccggtccctgtcctggtggcgggcgggcccgagaacggcgcggacctgagcggctacgcg
cgagccgtgctcgacgccggatgcgccggactggccgtcgggcggcgggtgttcaccagc
gcggaccccgaacgtctggtccgcgacctcgccgagaccgtgcacgcgccgcgcgacctc
acggacctgccgtcgcccgtcgccgggctgtacgacacggtcgccacgctctga

DBGET integrated database retrieval system