KEGG   Streptomyces formicae: KY5_7048cHelp
Entry
KY5_7048c         CDS       T05416                                 

Definition
(GenBank) ATP-dependent DNA ligase LigC
Organism
sfk  Streptomyces formicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ATL32066
UniProt: A0A291QKM7
LinkDB All DBs
Position
complement(8211597..8212667)
Genome map
AA seq 356 aa AA seqDB search
MDLPVTPPVKPMLAKPVAKIPPDMQYEAKWDGFRAIVYRDGDEVELGSRTGKPLTRYFPE
LVAALRERLPARCVLDGEIVIARDGRLDFDALTERIHPAESRVALLAERTPASFVAFDLL
ALGDDALLDTPLTERRATLEQALSGVTAPVHIAPATRDPEVARRWFEQFEGAGLDGVIAK
PLDLLYRQDERLMFKIKHARTADCVVAGYRFHKSGPVVGSLLLGLYDDGGVLQHVGVCAA
FPMKRRAELVEELEPLRMESTQGHPWAAWTDEAAHESARLPGAPSRWSGKKDLSWVALRP
ERVCEVAYDHMEGGRRFRHTARFRTWRPDRTPEGCTFAQLEEPVRYDLTDVLGPQR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggacctgccggtgacgccccccgtgaagcccatgctcgccaagcccgtggcgaagatc
ccgccggacatgcagtacgaggccaagtgggacgggttccgggcgatcgtctaccgcgac
ggggacgaggtcgagctcggcagccgtacgggcaagccgctgacccgctacttccccgag
ctggtggccgccctgcgggagcggcttccggcacgctgcgtgctggacggcgagatcgtg
atcgccagggacgggcggctcgacttcgacgcgctcacggagcgcatccatcccgccgag
tcgcgcgtcgccctgctcgcggagcggaccccggcctccttcgtcgccttcgacctgctc
gccctcggcgacgacgcgctgctcgacacgccgctcaccgagcgccgggccactctggag
caggccctgtccggcgtcacggcccccgtccacatcgccccggcgaccagggaccccgag
gtggcgcggcggtggttcgagcagttcgagggcgcgggcctggacggcgtgatcgccaag
ccgctcgacctgctctaccggcaggacgaacgcctcatgttcaagatcaagcacgcccgc
acggcggactgcgtggtcgcggggtaccgcttccacaagagcgggcccgtcgtcggctcg
ctgctgctcggtctctacgacgacgggggcgtcctgcagcacgtcggcgtctgtgcggcg
ttccccatgaagcggcgggccgagctcgtcgaggagctggagccgctgcggatggagtcg
acgcaggggcacccgtgggcggcctggaccgacgaggcggcccacgagagcgcccgcctg
cccggcgccccgagccgctggtcgggcaagaaggacctctcctgggtggcgctgcgcccg
gaacgggtctgcgaagtggcgtacgaccacatggagggcggccggcgcttccgccacacg
gcccgcttccgcacctggcgccccgaccgcaccccggagggctgcaccttcgcccagttg
gaggagccggtgcgctacgacctcacggacgtgctcgggccacagcgctga

DBGET integrated database retrieval system