Streptomyces formicae: KY5_7444 Help Entry KY5_7444          CDS       T05416                                  Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism sfk  Streptomyces formicae Pathway sfk00261   Monobactam biosynthesis sfk01100   Metabolic pathways sfk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KY5_7444  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sfk01008]     KY5_7444 Polyketide biosynthesis proteins [BR:sfk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KY5_7444 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  ATL32462 UniProt:  A0A291QLM3 LinkDB All DBs Position 8741583..8741807 Genome browser AA seq 74 aa AA seqDB search MPNPFDDENGTFLVLVNDENQHSLWPSFAEVPAGWKAVFGEDTRTACLDYIEEHWTDMRP KSLIEEMDKYEAAS NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgccgaacccgttcgacgacgaaaacggcaccttcctcgttctcgtcaacgacgagaac cagcactcgctgtggccctccttcgccgaggtgcccgccggttggaaggccgtcttcgga gaggacacccggacggcctgcctcgactacatcgaggagcactggacggacatgcgcccc aagagcctcatcgaggaaatggacaagtacgaagccgccagctag

DBGET integrated database retrieval system