KEGG   Streptomyces formicae: KY5_7757Help
Entry
KY5_7757          CDS       T05416                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sfk  Streptomyces formicae
Pathway
sfk00250  Alanine, aspartate and glutamate metabolism
sfk00410  beta-Alanine metabolism
sfk00430  Taurine and hypotaurine metabolism
sfk00650  Butanoate metabolism
sfk01100  Metabolic pathways
sfk01110  Biosynthesis of secondary metabolites
sfk01120  Microbial metabolism in diverse environments
sfk02024  Quorum sensing
Module
sfk_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sfk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KY5_7757
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KY5_7757
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KY5_7757
   00430 Taurine and hypotaurine metabolism
    KY5_7757
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    KY5_7757
Enzymes [BR:sfk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     KY5_7757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ATL32775
UniProt: A0A291QMW8
LinkDB All DBs
Position
9109625..9111019
Genome map
AA seq 464 aa AA seqDB search
MPLHRTTHHPVKPGSPFDDVYALPISEQILPKYKMPRSASDPRAVRELIHDELALDGNAS
QNLATFCTTWAEPEVHGLMNECLDKNMVDKDEYPQTAEIENRCVHMLADLWNSPEGETTL
GCSTTGSSEACMLGGLALKWRWRKRREAEGKSTDRPNIVAGPVQVCWEKFARYFDVELRQ
VPLEEDALGMRAEQLKDYVDENTIGVVAILGVTFTCAYEPVAEIVAELDRIQAETGLDIP
VHVDAASGGFLAPFLHPELVWDFRLARVASINTSGHKYGMAPLGVGWVVWRSADLLPEDL
IFRVNYLGGDLPTFALNFSRPGGEIVAQYYTMLRLGHEGYRKVYEACAATAHMLAERIEK
MGPFTVLYDGRGALPAVSWKLADPATAGFTLYDLTEEVRKRGWQVPAYPLPAGRDDTVIQ
RVLVRHGTGHDKIGLLADDIGAAVDRLMTSGPGGHAPEQPGFHH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgcaccggaccacgcatcaccccgtcaagcccggcagccccttcgacgacgtc
tacgcgctgccgatcagcgaacagatcctgcccaagtacaagatgccgcgctcggcctcc
gacccccgtgccgtccgtgaactgatccacgacgagctcgcgctcgacggcaacgcctcg
cagaacctcgccacgttctgcaccacctgggccgagcccgaggtgcacgggctcatgaac
gagtgcctcgacaagaacatggtcgacaaggacgagtacccgcagacggccgagatcgag
aaccgctgtgtgcacatgctcgccgacctgtggaactcgccggagggggagaccaccctc
ggctgctccaccaccggctccagcgaggcctgcatgctcggcggcctcgccctcaaatgg
cgctggcgcaagcgccgcgaggccgagggcaagtccacggaccggcccaacatcgtcgcg
gggcccgtgcaggtgtgctgggagaagttcgcccgctacttcgacgtggaactacggcaa
gtcccgctggaggaggacgcgttgggcatgcgcgccgagcagctcaaggactacgtggac
gagaacaccatcggagtcgtcgccatcctcggcgtcaccttcacctgcgcctacgaaccg
gtcgccgagatcgtcgccgaactcgaccgcatccaggccgagacgggcctcgacatcccc
gtccacgtggacgcggcgagcggcggcttcctcgccccgttcctccaccccgaactggtc
tgggacttccggctggcgcgcgtcgcctccatcaacacctcggggcacaagtacggcatg
gcaccgctcggcgtcggctgggtggtgtggcgctccgccgacctgctccccgaggacctg
atcttccgcgtgaactacctcggtggcgacctgcccaccttcgccctcaacttctcccgc
cccggcggcgagatcgtcgcccagtactacaccatgctgcgcctgggccacgagggctac
cgcaaggtgtacgaggcgtgcgcggccaccgcccacatgctggccgaacggatcgagaag
atgggtcctttcaccgtcctgtacgacgggaggggcgcgctgcccgccgtctcctggaag
ctcgccgacccggccacggccgggttcaccctctacgacctgaccgaagaggtgcgcaag
cgcggctggcaggtgcccgcctatccgctgcccgccgggcgtgacgacaccgtcatccag
cgggtcctggtgcggcacggcaccggccacgacaagatcgggctgctcgccgacgacatc
ggcgccgccgtcgaccggctgatgacgtcgggccccggcggccacgcgcccgagcagccg
ggattccaccactga

DBGET integrated database retrieval system