KEGG   Streptomyces formicae: KY5_7847cHelp
Entry
KY5_7847c         CDS       T05416                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
sfk  Streptomyces formicae
Pathway
sfk00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sfk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KY5_7847c
Enzymes [BR:sfk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     KY5_7847c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14 Glyco_hydro_35 DUF4350 Cellulase
Motif
Other DBs
NCBI-ProteinID: ATL32865
UniProt: A0A291QN53
LinkDB All DBs
Position
complement(9252855..9254867)
Genome map
AA seq 670 aa AA seqDB search
MSEHLTSVPGLLYGGDYNPEQWPEEVWEQDVKLMREAGVTMVTVGVFSWAGLQPGPDSWD
FGWLDRLMDLLHAHGIAVDLATATASPPAWLVRAHPEILPVTADGVRLEFGSRQHYCPSS
EAYGQAAVRLTRKLAERYARHPALALWHIHNEYGDHVTECFCPRSAAHFRTWLREKYGTV
DALNHAWGTAFWSQRYGTYDEIEPPRAAPGPVNPTQLLDWRRFCSDALLALHRAERDVLA
ATSPDVPATTNFMSMMRELDYWRWAEHEDLVSDDAYPDPADPRAHVNASLNYDLMRSLKR
GRPWLLMEQAPSAVSWRPVNVPKKPGLQRLWSLQAVARGADGVMYFQWRASRAGAEKYHS
ALLPHRGTASRGWRETVRFGAELAGLAEVAGSRVTASVAIVLDWDSWWALEGADHPSALM
RWPDLLRPWYAALHTRGVTVDFVPPHADLTAYRAVLAPNLHLLRTADARRLTSYVREGGH
LVVGPFSGVVDEHDHLHDGGAPGPLREVLGVSVDEFWPVPDADAVSLASGARATVWSEWI
ETDGAETTDTYAAGPLTGQPAVTRHVHGSGVARYLSCHLPDHIGDVLGQALAEAGVTACA
PVPEGVEATVRTGADASYLFLLNHTDRPVTVDADDGTDLLTGAPIHGTVRLAPLGAAVVR
TLNSPGDMPS
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcacctgacgtccgtgcccggactgctctacggcggggactacaaccccgag
cagtggcccgaggaggtctgggaacaggacgtgaagctgatgcgggaggccggggtcacc
atggtcaccgtcggcgtcttctcctgggcgggtctccaacccgggcccgacagctgggac
ttcggctggctcgaccggctcatggacctgctgcacgcccacggcatcgccgtcgacctg
gcgaccgccaccgcgtcgccgcccgcctggctggtgcgcgcccaccccgagatcctaccg
gtcaccgccgacggcgtgcggctcgaattcggttcgcggcagcactactgcccctcctcc
gaggcgtacgggcaggccgcggtgcgcctgacgcgcaagctcgccgagcgctacgcacgc
catccggcgctcgccctgtggcacatccacaacgagtacggcgaccacgtcaccgagtgc
ttctgcccgcgctcagctgcgcacttccgcacctggctgcgcgagaagtacggcaccgtc
gacgccctcaaccacgcctggggcacggccttctggtcccagcgctacggcacgtacgac
gagatcgaaccgccgcgcgccgcgccgggccccgtcaatccgacccagctccttgactgg
cggcgcttctgctccgacgcactgctggccctgcaccgcgccgagcgggacgtcctcgcc
gcgacgagcccggacgtccccgccaccaccaacttcatgtcgatgatgagggaactcgac
tactggcggtgggccgagcacgaggacctcgtctccgacgacgcctaccccgaccccgcg
gacccgcgcgcccacgtcaacgcgtcgctcaactacgacctgatgcgctccctcaagcgc
ggcaggccctggctcctcatggaacaggccccgtccgcggtgagctggcgccccgtcaac
gtccccaagaagccgggactgcaacgcctgtggtcgctccaggcggtggccaggggcgcc
gacggcgtcatgtacttccagtggcgtgcctcgcgcgcgggcgccgagaagtaccacagc
gccctgctcccgcaccggggcacggcgtcgcgcggctggcgcgagaccgtccgcttcggc
gccgaactggccgggctcgccgaggtcgcgggcagccgcgtcaccgcgtccgtggcgatc
gtcctggactgggactcctggtgggccctcgaaggcgccgaccacccctcggccctgatg
cgctggcccgacctgctgcgcccctggtacgcggcactgcacacccgcggcgtcaccgtc
gacttcgtgcccccgcacgccgacctcaccgcctaccgggccgtgctcgcgccgaacctg
catctgctgcgcaccgccgacgcccggcgcctcacgtcgtacgtccgcgagggcggccac
ctcgtcgtcggcccgttcagcggcgtcgtcgacgagcacgaccacctccacgacgggggc
gcgcccgggccgctgcgggaggtgctcggggtgtccgtcgacgagttctggccggtgccc
gacgccgatgcggtgtcgctcgcgtccggcgccagggccaccgtctggagcgagtggatc
gagacggacggcgccgagacgaccgacacctacgccgcgggccccctcaccgggcagccc
gccgtcacccggcacgtccacggctcgggcgtcgcccggtatctgagctgtcatctcccc
gaccacatcggggacgtgctcggccaagcgctcgccgaggcgggcgtcaccgcgtgcgcg
ccggtccccgagggcgtcgaggccaccgtgcgcaccggcgccgacgcctcgtacctcttc
ctcctcaaccacacggaccgccccgtcacagtcgacgccgacgacggcacggatctgctg
accggtgcaccgattcacggcaccgtacgtctcgctccgctcggtgcggccgtcgtccgc
accctcaactcccctggagatatgccctcgtga

DBGET integrated database retrieval system