KEGG   Shigella flexneri 301 (serotype 2a): CP0271
Entry
CP0271            CDS       T00097                                 

Gene name
icsP_sopA
Definition
(RefSeq) outer membrane protease
  KO
K13520  outer membrane protease [EC:3.4.23.-]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
sfl05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:sfl00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    CP0271 (icsP_sopA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sfl01002]
    CP0271 (icsP_sopA)
Enzymes [BR:sfl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     CP0271 (icsP_sopA)
Peptidases and inhibitors [BR:sfl01002]
 Aspartic peptidases
  Family A26: omptin family
   CP0271 (icsP_sopA)
SSDB
Motif
Pfam: Omptin
Other DBs
NCBI-GeneID: 1238162
NCBI-ProteinID: NP_858404
UniProt: O33641
LinkDB
Position
pCP301:220300..221247
AA seq 315 aa
MKLKFFVLALCVPAIFTTHATTNYPLFIPDNISTDISLGSLSGKTKERVYHPKEGGRKIS
QLDWKYSNATIVRGGIDWKLIPKVSFGVSGWTTLGNQKASMVDKDWNNSNTPQVWTDQSW
HPNTHLRDANEFELNLKGWLLNNLDYRLGLIAGYQESRYSFNAMGGSYIYSENGGSRNKK
GAHPSGERTIGYKQLFKIPYIGLTANYRHENFEFGAELKYSGWVLSSDTDKHYQTETIFK
DEIKNQNYCSVAANIGYYVTPSAKFYIEGSRNYISNKKGDTSLYEQSTNISGTIKNSASI
EYIGFLTSAGIKYIF
NT seq 948 nt   +upstreamnt  +downstreamnt
atgaaattaaaattctttgtacttgcactttgtgtacctgcgatctttactacacatgct
accactaactatccacttttcataccggacaacatcagtacggatattagtctaggatct
ctgagtggcaaaacaaaagaacgcgtttatcatcccaaggaaggggggagaaaaattagt
caactggactggaaatacagtaatgcgactattgttagaggtggcatcgattggaagcta
attccaaaagtgtctttcggagtttccggttggactactttaggtaaccagaaagcaagc
atggttgataaagactggaacaattccaatacccctcaggtatggaccgaccagagctgg
catcccaatacgcatctccgtgatgctaacgaattcgagctgaatcttaaaggttggtta
ttaaataatttggattatcgacttggactaatagcaggttaccaagagagtcgttacagt
tttaatgcaatgggagggagttatatttatagtgaaaacggggggagcaggaataaaaaa
ggggcacatcctagtggtgaaagaacaataggttacaaacagctcttcaaaataccttat
attggattaactgctaattaccgccatgagaattttgagtttggagcagaactgaaatat
agtggttgggttctttcatctgatacagataaacactatcagactgagacaatttttaaa
gatgaaataaaaaaccaaaattactgctctgttgctgcgaatattggatactatgtcacc
cccagtgcaaaattttatatagaaggctccagaaattacatttctaataaaaaaggtgat
acatctctttatgagcaaagtaccaatatatctggcaccattaaaaatagtgcaagtatt
gaatatattggttttctcacttccgcaggtataaagtatattttttga

DBGET integrated database retrieval system