KEGG   Shigella flexneri 301 (serotype 2a): SF0141Help
Entry
SF0141            CDS       T00097                                 

Gene name
mrcB
Definition
(RefSeq) bifunctional glycosyl transferase/transpeptidase
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
sfl00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sfl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SF0141 (mrcB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sfl01003]
    SF0141 (mrcB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sfl01011]
    SF0141 (mrcB)
Enzymes [BR:sfl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     SF0141 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SF0141 (mrcB)
Glycosyltransferases [BR:sfl01003]
 Polysaccharide
  Bacterial polysaccharide
   SF0141 (mrcB)
Peptidoglycan biosynthesis and degradation proteins [BR:sfl01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   SF0141 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H PBP1_TM Transpeptidase UvrB_inter DUF3484
Motif
Other DBs
NCBI-GeneID: 1024458
NCBI-ProteinID: NP_706097
UniProt: A0A2S4MSR0
LinkDB All DBs
Position
156508..159042
Genome map
AA seq 844 aa AA seqDB search
MAGNDREPIGRKGKPTRPVKQKVSRRRYEDDDDYDDYDDYEDEEPMPRKGKGKGKGRKPR
GKRGWLWLLLKLAIVFAVLIAIYGVYLDQKIRSRIDGKVWQLPAAVYGRMVNLEPDMTIS
KNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFDGDHL
ATIVNMENNRQFGFFRLDPRLITMISSPNGEQRLFVPRSGFPDLLVDTLLATEDRHFYEH
DGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWRKANEAYMALIMDAR
YSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVKGASIY
NPWRNPKLALERRNLVLRLLQQQQIIDQELYDMLSARPLGVQPRGGVISPQPAFMQLVRQ
ELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVEGIPALKKQRKLSDLETAIVVVDRF
SGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATYLTALSQPKIYRLNTWIADAPIAL
RQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVPTVNLGMALGLPAVTETWIKLGVPK
DQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSFPQAER
AVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLHLAGKTGTTNNNVDTWFAGIDGSTVTI
TWVGRDNNQPTKLYGASGAMSIYQRYLANQTPTPLNLVPPEDIADMGVDYDGNFVCSGGM
RVLPVWTSDPQSLCQQSEMQQQPSGNPFDQSSQPQQQPQQQPAQQEQKDSDGVAGWIKDM
FGSN
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaatgaccgcgagccaattggacgcaaagggaaaccgacgcgtccggtcaaa
caaaaggtaagccgtcgtcgttacgaagatgacgatgattacgacgattatgatgactat
gaggatgaagaaccgatgccgcgcaaaggtaagggcaaaggcaaagggcgtaagcctcgt
ggcaaacgcggctggctatggctactgctaaaactggctatcgtttttgccgtgctgatc
gccatttacggcgtttatctcgatcaaaaaattcgtagccgtattgatggcaaggtctgg
caactgcccgcggcagtttatggccgaatggtcaaccttgaaccagatatgaccatcagc
aagaacgaaatggtgaagctgctggaggcaacacagtatcgtcaggtgtcgaaaatgacc
cgtcctggcgaatttaccgtgcaggccaacagcattgagatgatccgccgtccgtttgat
ttcccggacagtaaagaagggcaggtgcgtgcgcgtctgacctttgatggtgatcatctg
gcgaccatcgtcaatatggagaacaaccgtcagttcggtttcttccgtcttgatccgcgt
ctgatcaccatgatctcctcgccaaacggtgagcagcgtttgtttgtgccgcgcagtggt
ttccctgatttgctggtggatactttgctggcgacagaagaccgtcatttttacgagcat
gatggaatcagtctctactccattgggcgtgcggtgctggcaaacctgaccgcaggtcgc
acggtgcagggtgcgagtacgctgacgcaacagctggtgaaaaacctgttcctctccagc
gagcgttcttactggcgtaaagcgaacgaagcttacatggcgctgatcatggacgcgcgt
tacagcaaagaccgtattcttgagctgtatatgaacgaggtgtatctcggtcagagcggc
gacaacgaaatccgcggcttcccgctggcaagcttgtattactttggtcgcccggtagaa
gagctaagcctcgaccagcaggcgctgttagtcggtatggtgaaaggggcgtccatctac
aacccgtggcgtaacccgaaactggcgctggagcgacgtaatctggtgctgcgtctgctg
caacagcaacagattattgatcaagaactctatgacatgttgagtgcccgtccgctgggg
gttcagccgcgtggtggggtgatctctcctcagccagcctttatgcagctggtgcgtcag
gagttgcaggcaaaactgggcgataaggtaaaagatctctccggcgtgaagatcttcact
acctttgactcggtggcccaggacgcggcagaaaaagccgccgtggaaggcattccggca
ctgaagaaacagcgtaagttgagcgatcttgaaactgcgattgtggtcgtcgaccgcttt
agtggtgaagttcgtgcgatggtcggaggttctgagccgcagtttgcgggctacaaccgt
gcgatgcaggcgcgtcgttcgattggttcccttgcaaaaccagcgacttatctgacggct
ttaagccagccgaaaatctatcgcctgaacacgtggattgccgatgcgccaatcgcgctg
cgtcagccgaatggccaggtctggtcaccgcagaacgatgaccgtcgttatagcgaaagc
ggcagagtgatgctggtggatgcgttgacacgttcgatgaacgtgccgacggtaaatctg
gggatggcgctggggctgcctgcggttacggagacctggatcaaactgggcgtaccgaaa
gatcagttgcatccggttccggcaatgctgctgggggcgttgaacttaacgccaatcgaa
gtggcgcaggcattccagaccatcgccagcggtggtaaccgtgcaccgctttctgcactg
cgttcggtaatcgcggaagatggtaaggtgctgtatcagagcttcccgcaggcagaacgc
gctgttccggcgcaggcggcgtatctgacactatggaccatgcagcaggtggtacaacgt
ggtacgggtcgtcagcttggggcgaaatacccgaacctgcatctggcagggaaaacaggg
actaccaacaataacgtagatacctggtttgcaggcattgacggcagcacggtgaccatc
acctgggtaggccgtgataacaaccagccgaccaaactgtatggagccagcggggcaatg
tcgatttatcagcgttatctggctaaccagacgccaacgccgctgaatcttgttccgcca
gaagatattgcagatatgggcgtggactacgacggcaactttgtttgcagcggtggcatg
cgtgtcttgccggtctggaccagcgatccgcaatcgctgtgccagcagagcgagatgcag
cagcagccgtcaggcaatccgtttgatcagtcttctcagccgcagcaacagccgcaacag
caacctgctcagcaagagcagaaagacagcgacggtgtagccggttggatcaaggatatg
tttggtagtaattaa

DBGET integrated database retrieval system