KEGG   Shigella flexneri 301 (serotype 2a): SF0845Help
Entry
SF0845            CDS       T00097                                 

Gene name
cydC
Definition
(RefSeq) cysteine/glutathione ABC transporter membrane/ATP-binding protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
sfl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sfl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SF0845 (cydC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfl02000]
    SF0845 (cydC)
Transporters [BR:sfl02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    SF0845 (cydC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 SMC_N AAA_22 DUF87 NACHT AAA_16 RsgA_GTPase MMR_HSR1 FtsK_SpoIIIE AAA_29 T2SSE AAA_30 Rad17 AAA_23 AAA_5
Motif
Other DBs
NCBI-GeneID: 1023812
NCBI-ProteinID: NP_706771
UniProt: A0A0H2UZK9
LinkDB All DBs
Position
complement(878846..880567)
Genome map
AA seq 573 aa AA seqDB search
MRALLPYLALYKRHKWMLSLGIVLAIVTLLASIGLLTLSGWFLSASAVAGVAGLYSFNYM
LPAAGVRGAAITRTAGRYFERLVSHDATFRVLQHLRIYTFSKLLPLSPAGLARYRQGELL
NRVVADVDTLDHLYLRVISPLVGAFVVIMVVTIGLSFLDFTLAFTLGSVMLLTLFLMPPL
FYRAGKSTGQNLTHLRGQYRQQLTAWLQGQAELTIFGASDRYRTQLENTEIQWLEAQRRQ
SELTALSQAIMLLIGALAVILMLWMASGGVGGNAQPGALIALFVFCALAAFEALAPVTGA
FQHLGQVIASAVRISDLTDQKPEVTFPDTQTRVADRVSLTLRDVQFTYPKQSQQALKGIS
LQVNAGEHIAILGRTGCGKSTLLQLLTRAWDPQQGEILLNDSPIASLNEAALRQTISVVP
QRVHLFSATLRDNLLLASPGSSDEALSEILRRVGLEKLLEDAGLNSWLGEGGRQLSGGEL
RRLAIARTLLHDAPLVLLDEPTEGLDATTESQILELLAKMMREKTVLMVTHRLRGLSRFQ
QIIVMDNGQIIEQGTHAELLARQGRYYQFKQGL
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctttgctaccctatctggcactgtataaacgtcataaatggatgttaagtctt
ggtattgtgctggcaattgtgacgctgctcgccagtatcggtctgttgacactttccggc
tggttcctctcggcctcagcggttgcgggggttgccggactgtacagcttcaactatatg
ctacccgctgcgggcgtgcgtggtgccgcaatcacccgtactgccgggcgttattttgaa
cgtctggtaagtcacgacgcgactttccgcgtgttgcagcatctgcgcatttacaccttc
agcaaattgttgcccctctcccctgccggactggcgcgctatcgtcagggcgaattgctc
aaccgcgtggtggcggatgttgatacgctcgatcatctttacctgcgcgttatctcgccg
ctggtgggcgcttttgtggtgattatggtggtgacaatcgggttaagtttccttgatttc
accctcgcctttacgctgggcagcgttatgttactgacgcttttcctgatgccaccgctg
ttttatcgtgcgggaaaaagcaccgggcaaaatctgactcatcttcgcggacagtatcgc
caacaactgacggcctggctgcaagggcaagctgagctgaccatttttggtgccagcgat
cgttatcgcacgcaactagagaatacagaaattcaatggctggaagcgcaacgccgtcaa
tctgaactgaccgcattgtcgcaagcgataatgctgctcattggcgcgttagcggtgatc
ctgatgctgtggatggcgtctggcggcgttggcggcaatgctcaacccggcgcattaatt
gccctgtttgtcttttgtgcgttagccgcgtttgaagcactggcaccagtaacgggtgca
tttcagcatctggggcaagtcattgcctctgccgtacgtatctctgacttaacggatcaa
aaaccggaggtcaccttccctgatacccaaactcgtgttgccgatcgcgtttcgctgaca
ttacgggatgttcagttcacttatccgaagcaatcccaacaggcacttaaagggatttct
cttcaggtaaacgccggggaacatatagcgattctcgggcgaaccggatgcggcaaatca
acactgttacaactgctgacccgcgcatgggacccgcaacagggcgagattttgcttaac
gatagccccatagccagcctgaatgaagcggctctacgacagaccatcagcgttgttcct
cagcgagtgcatctgtttagcgccacactgcgtgataatctgttactcgcctcgcctggc
agtagtgatgaggctctgtcggagatcttgcgtcgcgttggtctggagaagctgctcgag
gatgcaggtctcaacagttggttaggtgaaggcggacgccagctctccggtggtgaactg
cgccgtctggctatcgcccgtacgctgttacatgatgcgccactggtgttgctggatgaa
cctaccgaaggcttagatgccacaaccgaaagccagatccttgaattgcttgcaaaaatg
atgcgtgagaaaacggtgttaatggtcacccatcgacttcgcggactctctcgtttccaa
caaataatagtgatggacaacgggcaaattattgagcaaggtactcacgcagaactgctt
gccagacaggggcgttattaccagttcaagcagggtttgtaa

DBGET integrated database retrieval system