KEGG   Shigella flexneri 301 (serotype 2a): SF1970Help
Entry
SF1970            CDS       T00097                                 

Gene name
amyA
Definition
(RefSeq) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
sfl00500  Starch and sucrose metabolism
sfl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SF1970 (amyA)
Enzymes [BR:sfl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SF1970 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939 Malt_amylase_C
Motif
Other DBs
NCBI-GeneID: 1025158
NCBI-ProteinID: NP_707813
UniProt: A0A0H2V050
LinkDB All DBs
Position
2002301..2003788
Genome map
AA seq 495 aa AA seqDB search
MRNPTLLQCFHWYYPEGGKLWPELAERADGFNDIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSIPTKYGDKAQLLAAIDALKRNDIAVLLDVVVNHKMGADEKEAIRVQRV
NADDRTQIDEEIIECEGWTRYTFPARAGQYSQFIWDFKCFSGIDHIEHPDEDGIFKIVND
YTGEGWNDQVDDELGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTQCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPKPLFIVAECWSHEVDKLQTYIDQVEGKTMLFDAPLQMKFHEAS
RMGRDYDMTQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEPWFKPLAYALILLREN
GVPSVFYPDLYGAHYEDVGGDGQTYPIDMPIIEQLDELILARQRFAHGVQTLFFDHPNCI
AFIRSGTDEYPGCVVVMSNGDDGEKTIHLGENYGNKTWRDFLGNRQESVVTDENGEATFF
CNGGSVSVWVIEEVI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatcccacgctgttacaatgttttcactggtattacccggaaggcggtaagctc
tggcctgaactggccgagcgcgcagacggttttaatgatattggtatcaatatggtctgg
ttgccgcccgcctataaaggcgcatcgggcggctattcggtcggctacgactcctatgat
ttatttgatctaggtgagtttgatcagaaaggcagcatccctactaaatatggtgataaa
gcacaactgctggccgccattgacgccctgaaacgtaatgacattgcggtgctgctggac
gtggtagtcaaccacaaaatgggcgcggatgaaaaagaagctattcgcgtgcagcgtgta
aatgctgatgaccgtacgcaaattgacgaagaaatcattgagtgtgaaggctggacgcgt
tacaccttccccgctcgtgccgggcaatactcgcagtttatctgggatttcaaatgtttt
agcggtatcgaccatatcgaacaccctgatgaagatggcatttttaaaattgttaacgac
tataccggagaaggctggaacgatcaggttgatgatgaactcggtaatttcgattatctg
atgggtgagaatatcgattttcgcaatcatgccgtgacggaagagattaaatactgggcg
cgctgggtgatggaacaaacgcaatgcgacggctttcgtcttgatgcggtcaaacatatt
ccggcatggttttataaagagtggatcgaacacgtacaggaagttgcgccaaagccgctg
tttattgtggctgaatgctggtcgcatgaagtcgataaactgcaaacgtatattgatcag
gtggaaggcaaaaccatgctgtttgatgcgccgctgcagatgaaattccatgaagcatcg
cgcatgggtcgcgactacgacatgacgcagatcttcactgggacgctggtggaagccgat
ccttttcacgccgtaaccctcgttgccaaccacgacacccaaccgttgcaagccctcgaa
gcaccggtcgaaccgtggtttaaaccgctggcgtatgccttaattttgttgcgggaaaat
ggcgttccttcggtgttctatccggacctctacggtgcacattacgaagatgtcggtggt
gacgggcaaacctatccgatagatatgccaataatcgaacagcttgatgagttaattctc
gcccgtcagcgtttcgcccacggtgtacagacattatttttcgaccatccgaactgcatt
gcctttatccgcagtggcaccgacgaatatcccggctgcgtggtggtcatgtcgaacgga
gatgatggcgaaaaaaccattcatctgggagagaattacggcaataaaacctggcgtgat
tttctggggaaccggcaagagagcgtagtgacagacgaaaacggcgaagcgaccttcttt
tgcaacggcggcagcgtcagcgtgtgggttatcgaagaggtgatttaa

DBGET integrated database retrieval system