KEGG   Shigella flexneri 301 (serotype 2a): SF3448Help
Entry
SF3448            CDS       T00097                                 

Gene name
glpD
Definition
(RefSeq) sn-glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
sfl00564  Glycerophospholipid metabolism
sfl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SF3448 (glpD)
Enzymes [BR:sfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SF3448 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-GeneID: 1026759
NCBI-ProteinID: NP_709201
UniProt: A0A0H2V2A5
LinkDB All DBs
Position
3533209..3534729
Genome map
AA seq 506 aa AA seqDB search
MNEGSMETKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRY
LEHYEFRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRT
SLPGSTGLRFGANSVLKPEIKRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSA
RRENGLWIVEAEDIDTGKKYSWQARGLVNATGPWVKQFFDEGMHLPSPYGIRLIKGSHIV
VPRVHTQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLKV
YNAHFKKQLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKL
TTYRKLAEHALEKLTPYYQGIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLAR
HYTRTYGSNSELLLGNAGTVSDLGEDFGHEFYEAELKYLVDHEWVRRTDDALWRRTKQGM
WLNADQQSRVSQWLVEYTQQKLSLAS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgagggcagcatggaaaccaaagatctgattgtgataggtggcggcatcaatggt
gctggtatcgcggcagacgccgctggacgcggtttatccgtgctgatgctggaggcgcag
gatctcgcttgcgcgacctcttccgccagttcaaaactcattcacggtggcctgcgctac
cttgagcactatgaattccgcctggtcagcgaggcgctggctgaacgtgaagtgctgctg
aaaatggctccgcatatcgccttcccgatgcgttttcgcctgccacatcgtccgcatctg
cgcccggcgtggatgattcgcattggtctgtttatgtacgatcatctgggtaaacgcacc
agcctgccgggatcaactggtttgcgttttggcgcaaattcagtgttaaaaccggaaatt
aagcgcggattcgaatattctgactgttgggtagacgacgcccgtctggtactcgccaac
gcccagatggtggtgcgtaaaggcggcgaagtgcttactcggactcgcgccacctctgct
cgccgcgaaaacggcctgtggattgtggaagcggaagatatcgataccggcaaaaaatat
agctggcaagcgcgcggcctggttaacgccaccggcccgtgggtgaaacagttcttcgac
gaggggatgcatctgccttcgccttatggcattcgcctgatcaaaggcagccatattgtg
gtgccgcgcgtgcatacccaaaagcaggcctacattctgcaaaacgaagataaacgcatt
gtgttcgtgatcccgtggatggacgagttttccatcatcggcaccaccgatgtggaatac
aaaggtgatccgaaagcagtgaagattgaagagagtgaaatcaattacctgctgaaagtg
tataacgcgcactttaaaaagcagctaagccgtgacgatatcgtctggacctactccggt
gtgcgtccgctgtgtgatgatgagtccgactcgccgcaagccattacccgtgattacacc
cttgatatccatgatgaaaacggcaaagcaccgctgctgtcggtattcggcggtaagctg
accacctaccgaaaactggcagaacatgcgctggaaaaactgacgccgtattatcagggt
attggcccggcgtggacgaaagagagcgtgctgccgggtggtgccattgaaggcgaccgc
gacgattacgccgctcgcctgcgccgccgttacccgttcctgactgaatcgctggcacgt
cactacacgcgcacttacggcagcaacagcgagctgctgctcggcaatgcgggaacggta
agcgatctcggggaagatttcggtcatgagttctacgaagcggaactgaaatacctggtg
gatcacgaatgggtccgccgcaccgacgatgccctgtggcgtcgcacaaaacaaggcatg
tggctgaatgcggatcaacaatctcgtgtgagtcagtggctggtggaatatacgcagcag
aagttgtcgctggcgtcgtaa

DBGET integrated database retrieval system