KEGG   Sphingorhabdus flavimaris: SPHFLASMR4Y_00093Help
Entry
SPHFLASMR4Y_00093 CDS       T04949                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sfla  Sphingorhabdus flavimaris
Pathway
sfla00473  D-Alanine metabolism
sfla00550  Peptidoglycan biosynthesis
sfla01100  Metabolic pathways
sfla01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sfla00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SPHFLASMR4Y_00093 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SPHFLASMR4Y_00093 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    SPHFLASMR4Y_00093 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sfla01011]
    SPHFLASMR4Y_00093 (ddlB)
Enzymes [BR:sfla01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SPHFLASMR4Y_00093 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:sfla01011]
 Precursor biosynthesis
  Amino acid ligase
   SPHFLASMR4Y_00093 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ASK86887
UniProt: A0A220W240
LinkDB All DBs
Position
108380..109312
Genome map
AA seq 310 aa AA seqDB search
MTAKDKNSLHIAVLMGGWSAEREVSLSSGKGVADALEKNGHQVTRVDMDRNVAQVLAGIR
PDVVFNALHGVPGEDGSVQGMLDLMQIPYTHSGLATSVIAIDKELTKQQLVPAGVPMPKG
RIVSSASLHDADPLPRPYVLKPVNEGSSVGVAIVTDDSNYGHPISRDAAGPWQEFDQLLA
EPFIKGRELTTAVLGGKALCVTELRTAQGFYDYEAKYTEGLTQHVCPAEIPADIEKLCLD
YALRAHQILGCKGTSRTDFRWDDEQGAAGLFVLETNTQPGMTPLSLVPEQAKQMGISYEE
LVEIIVREAL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaaagacaaaaacagcctccatatcgccgtcctgatgggcggatggtccgcc
gaacgggaagtgtcgctgagcagcggcaagggcgtcgccgatgcgctggagaaaaacggc
catcaggtgacccgcgtcgacatggaccgcaatgtcgcacaggtgcttgccggcatccgt
cccgatgtggtgttcaacgcgttgcacggcgttcccggtgaagacggcagcgtccagggc
atgctcgatctgatgcaaatcccctatacccatagcgggctcgccacgtcggtaatcgcg
atcgacaaggaattgaccaagcagcagctggtacccgccggcgtcccgatgcccaagggc
aggattgtctccagcgccagcctccatgacgccgatccgttgccgcgaccctatgtcctc
aagccggtcaacgagggctcttccgtcggtgtcgcgatcgtgaccgacgacagcaattac
gggcatccgatcagccgcgatgcggcggggccgtggcaggagtttgaccagcttctggcc
gaacccttcatcaaggggcgcgaactgaccacggctgttctcggcggcaaggcgctttgc
gtaactgaattgaggacggctcagggcttttatgattatgaagccaaatatacagagggc
ctgacccagcatgtctgccccgccgaaattcctgccgatatcgagaaactgtgtctcgac
tatgctctgcgcgcccaccagattttggggtgcaaagggacttcgcgcacagatttccgc
tgggacgacgagcagggcgcggcggggctgtttgtgctggaaaccaacacgcagcccggc
atgactccgctcagcctggtccccgagcaggcgaaacagatgggaatcagctatgaagag
ctggtcgagataatcgtgagagaagccctatga

DBGET integrated database retrieval system