KEGG   Sphingorhabdus sp. SMR4y: SPHFLASMR4Y_00752Help
Entry
SPHFLASMR4Y_00752 CDS       T04949                                 

Gene name
fixJ
Definition
(GenBank) DNA-binding response regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
sfla  Sphingorhabdus sp. SMR4y
Brite
KEGG Orthology (KO) [BR:sfla00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sfla02022]
    SPHFLASMR4Y_00752 (fixJ)
Two-component system [BR:sfla02022]
 OmpR family
  Unclassified
   SPHFLASMR4Y_00752 (fixJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C MTD
Motif
Other DBs
NCBI-ProteinID: ASK87534
UniProt: A0A220W428
LinkDB All DBs
Position
779686..780405
Genome map
AA seq 239 aa AA seqDB search
MTNKIHILLVDDEVSLREPLAEYLIKQGYKVQQAADASIARSLLNAYDFDIILLDIMMPG
EDGLSLCRHVTDKTDIPVIFISAKTEETERIIGLELGADDYITKPFSPRELVARIKVVLR
RAEKNGVAHNGTSGGVYQFSGWTLKCDKRSLVDSEGVSVSLSTGEYQMLLALVSRAGKVL
NRDQLLDITQGREAHAFDRAVDNQISRLRRKIEADPKNPEIIKTVWGGGYVLAGEVKSL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacaagatacatatattgctggttgatgatgaggtttcgctgcgcgaacctttg
gccgaatatcttatcaaacagggttacaaggtgcagcaggctgccgatgccagcatcgcg
cggtcgctgctcaatgcttacgatttcgatatcatcctgctcgacatcatgatgcccggc
gaagacgggctcagcctgtgccggcatgtcaccgacaagaccgacattccggtcattttc
atcagcgccaagaccgaggaaaccgaacggatcatcggcctcgaactgggcgccgacgac
tatattacgaaacccttcagcccgcgcgaactggtcgcgcggatcaaggtcgtgttgcgc
cgcgccgaaaagaacggcgtcgcgcacaacggcacgagcggcggcgtctatcaattttcg
ggctggaccctgaaatgtgacaagagaagtctggtcgactccgaaggtgtgagcgtgtcg
ctctcgaccggcgaatatcagatgctgctggccctggtgtcccgcgccggcaaggttctc
aaccgtgatcaactgctcgacattacccagggtcgcgaagcccatgcgtttgaccgcgcc
gtcgacaaccagatcagccggttgcgtcgcaagatcgaggctgatccgaaaaatcccgaa
atcatcaagaccgtctggggcggcggctatgtactggccggcgaggtgaaatccctgtga

DBGET integrated database retrieval system