KEGG   Sphingorhabdus sp. SMR4y: SPHFLASMR4Y_00840Help
Entry
SPHFLASMR4Y_00840 CDS       T04949                                 

Gene name
ilvD
Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
sfla  Sphingorhabdus sp. SMR4y
Pathway
sfla00290  Valine, leucine and isoleucine biosynthesis
sfla00770  Pantothenate and CoA biosynthesis
sfla01100  Metabolic pathways
sfla01110  Biosynthesis of secondary metabolites
sfla01130  Biosynthesis of antibiotics
sfla01210  2-Oxocarboxylic acid metabolism
sfla01230  Biosynthesis of amino acids
Module
sfla_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
sfla_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sfla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SPHFLASMR4Y_00840 (ilvD)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SPHFLASMR4Y_00840 (ilvD)
Enzymes [BR:sfla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     SPHFLASMR4Y_00840 (ilvD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: ASK87620
UniProt: A0A220W476
LinkDB All DBs
Position
complement(883057..884778)
Genome map
AA seq 573 aa AA seqDB search
MTNRFDKSRLPSRHVSVGPERAPQRSYYYAMGMTEEDIAKPFVGIASAGNDSAPCNTLLD
GQADIAREGVIEGGGTPRRFNTITVTDGIAMGHQGMKASLVSREVIADSVELSVRGHCYD
AVIGYAGCDKSLPGMMMAMLRLNVPSIFVYGGSILPGRFHDHDVTVVDVFEAVGQHSAGN
CPLQELIELEKVACPGHGACGGQFTANTMACVAEAIGLSLPNSNMAPAPYETRDDMARAA
GRQIMNLIELNLRPRDICTKDAFINAARVVAATGGSTNAALHLPAMASEAGIDFDLFDVA
EIFKTTPYLADLKPGGKYVAKDMHDAGGVYMLMKTMMDNGLIKGDCITVTGKTLGENIEE
IVWNPDQKVIYDVQNAITPTGGVVGLRGSLAPEGAIVKVAGMARLQFRGPAQVFECEEDA
FDAVEDRQIKEGAVVVIRNEGPKGGPGMREMLATTAALYGQGMGEKVALITDGRFSGATR
GFCIGHVGPEAADGGPIGLIEDGDMINIDAEKGIIDLEVDEAILAERRKNFTQRETDYGS
GTLWRYAQNVGPAYKGAVTHPGAKAEKHVYADI
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacagattcgataaatcccgcttgcccagccgtcacgtcagtgtcggtcccgaa
cgcgcgccccagcgcagctattattatgcaatgggcatgaccgaagaagatatcgcaaaa
ccttttgtcggaatcgcttccgcgggtaacgacagcgcgccctgcaacacattgctcgac
ggtcaggctgatattgcgcgggaaggcgtgatcgaaggcggcggcaccccgcggcggttc
aacacgatcaccgtgaccgacggcattgccatgggccaccagggcatgaaggcctcgctg
gtctcccgcgaagtcatagccgacagcgtcgaactgagcgttcgcggccactgctatgac
gcggtgatcggctatgccggttgcgacaagagcctgcccggcatgatgatggcgatgctg
cggctcaatgtcccgtcaatatttgtctatggcggctctatcctgcccggccgtttccac
gaccatgatgtcaccgtggtggacgtctttgaagccgtcggacagcatagcgccggcaat
tgcccgttgcaggaactgatcgaactcgagaaagtcgcctgcccggggcacggtgcctgt
ggcggccagtttaccgccaacaccatggcctgcgttgccgaagcgatcggcctgtcgctg
ccgaacagcaatatggcaccggccccctatgaaacccgcgacgacatggcgcgcgccgcc
ggtcgtcagatcatgaacctgatcgaactcaatctgcggccgcgcgatatttgtacaaag
gatgccttcatcaacgccgcgcgcgtggtcgccgccaccggaggctcgaccaacgccgcc
ttgcaccttccggcaatggccagcgaagcgggtatcgactttgacctgttcgatgtcgcc
gaaatcttcaagaccacgccctatctggccgacctgaaaccgggcggcaaatatgtcgcc
aaggacatgcatgatgccggcggtgtctacatgttgatgaagacgatgatggacaacggg
ctgatcaagggcgactgcatcaccgtcaccggcaagacgctcggcgagaatatcgaggaa
atcgtctggaacccggaccagaaagtgatctacgacgtacaaaatgcgatcacgccaacc
ggcggtgttgtcggtctgcgcggttccctggccccggaaggcgctatcgtgaaagtcgcc
ggcatggcccgcctgcagttccgtggcccggcccaggttttcgaatgcgaggaagatgct
tttgatgccgtcgaggaccggcagatcaaggagggcgccgtagtcgtcatccgcaacgaa
gggcctaagggcggccccggcatgcgcgagatgctagccaccaccgctgcgctttacggc
cagggtatgggcgagaaagtcgcgctgatcaccgatgggcgcttctccggtgccacccgt
ggtttctgcatcggccatgtcggaccggaggcggccgatggagggcctatcggcttgatc
gaggacggcgacatgatcaatatcgatgccgaaaagggcatcatcgatctggaagtcgac
gaggcgatattggccgagcggcggaaaaacttcacgcaacgcgaaaccgattatggttcc
ggtacgttgtggcgctatgctcagaatgttgggccggcctataagggtgcggtcacccat
ccgggggccaaggcggaaaaacatgtctatgcggatatatag

DBGET integrated database retrieval system