KEGG   Sphingorhabdus flavimaris: SPHFLASMR4Y_00851Help
Entry
SPHFLASMR4Y_00851 CDS       T04949                                 

Definition
(GenBank) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sfla  Sphingorhabdus flavimaris
Brite
Enzymes [BR:sfla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     SPHFLASMR4Y_00851
Peptidases [BR:sfla01002]
 Metallo Peptidases
  Family M2
   SPHFLASMR4Y_00851
Exosome [BR:sfla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPHFLASMR4Y_00851
CD molecules [BR:sfla04090]
 Proteins
  SPHFLASMR4Y_00851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ASK87631
UniProt: A0A220W4A4
LinkDB All DBs
Position
complement(895726..897564)
Genome map
AA seq 612 aa AA seqDB search
MKTAASIVAIATMALSTPALAKHHEKDAMEETAAPTAADAEQFVAETEQKLFDFSIDAAR
IYWINANFITDDTDALAAKAGAEGTTMSVNAAIEAAKFNDVKGLDAVTRRKLDKLRGGIV
LPAPTTDGAATELNEIATKLNSAYGKGKGTLNDEEINGSDIEAAMGTNRNPEELAEMWES
WHTNVGAPMKDDYARMVEIANQGAQELGFADVGAMWRSGYDMPADDFAKLTDKLWAQVKP
LYDQLHCYTRDKLNEEYGDAVQPETGPIRADLLGNMWAQEWGNIYDIVAPEGAGDIGYDT
TELLAANDYDAMKMVKAGEGFFSSLGFEPLPETFYERSLFTKPADREVVCHASAWDIDNK
DDIRIKMCIKVNGDDFITIHHELGHNYYQRAYNEQSYLHLDGANDGFHEAIGDMVALSIT
PEYLVQVGLLDAEKVPSADKDVGLLLRQAMDKVAFLPFGLLVDKWRWQVFSGDIQPDNYT
QAWHDLKLEYQGITPPVDRPADAFDPGAKYHIPGNTPYSRYFLARILQFQFYKAACDEAG
WTGPLHRCSFYGNEQVGAKLNAMLEMGASKPWPDALEAFTGTREMDGSAMISYFAPLMDW
LKEENKGKSCGW
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgccgcttcgatcgttgcaattgccaccatggccctgtctactcctgctctg
gccaagcatcatgaaaaagatgccatggaggaaacggctgcaccgacagccgccgatgct
gagcaatttgtagccgagaccgaacagaagctgtttgatttctcgatcgacgccgcccgg
atttactggatcaacgcgaatttcatcaccgacgacacggacgcgctggcggccaaggcc
ggcgcagagggaacgacgatgtcggtgaacgcagctatcgaagcggcaaaattcaacgac
gtcaaagggctggatgcggttacgcgtcgcaagctcgacaaattgcgcggcgggattgtg
ctgcctgcaccgactacggatggcgccgccaccgaattgaacgagatcgcgaccaagctg
aactcggcctatggcaagggcaagggcacgctcaacgacgaggaaatcaacggatcggac
atcgaagccgccatgggcaccaaccgcaaccccgaagaattggctgaaatgtgggaaagc
tggcacacaaatgtcggcgcgccgatgaaggatgattatgcccgtatggtcgaaatcgcc
aatcaaggggcccaggaactcggttttgccgacgtcggtgcgatgtggcggtccggctat
gacatgccggccgacgatttcgccaagctgaccgacaagctctgggcgcaggtcaaaccg
ttatatgaccagctgcactgctacacgcgcgacaagctcaacgaagaatatggtgatgcg
gttcagcccgaaaccggaccgattcgcgccgatctgctcggcaatatgtgggcccaggaa
tggggcaatatctatgatatcgtggcacccgaaggggctggtgacatcggttatgatacg
accgaattgctggcggccaatgattatgacgcgatgaagatggtgaaggccggcgaaggt
ttcttctcctccttaggtttcgagccgctgccggaaacattctacgaacgctcgctcttc
accaagccggctgaccgggaagtcgtctgtcacgccagcgcctgggatatcgacaacaag
gacgatatccggatcaagatgtgcatcaaggtgaatggcgacgatttcatcaccatccac
cacgagctgggccacaattattaccagcgtgcctataacgagcagagctacctgcacctc
gacggcgccaatgacggtttccacgaggcaatcggtgatatggtcgcactatcgatcaca
ccggaatatctggtccaggttggtttgctcgacgccgaaaaggttcccagcgcggacaag
gatgtcggcctgctgttgcgtcaggcaatggacaaggttgcgttcctgccgtttggcctg
ctggtcgacaagtggcgctggcaggtgttctcgggcgatatccagccggacaattacacc
caggcctggcatgatctgaagctggaatatcagggcatcacgccaccggttgaccggcct
gccgatgctttcgatccgggcgcaaaatatcatattcccggcaatacgccttattcgcgc
tatttcctcgcccggatcctgcagttccagttctacaaggccgcctgcgatgaagccgga
tggaccggaccgctgcaccgctgttccttctatggtaacgagcaggtcggcgccaagctg
aacgcaatgctcgaaatgggcgcttccaagccttggcccgacgcgctggaagcctttacc
gggacgcgggaaatggatggatcggcgatgatcagctattttgccccgctaatggactgg
ctgaaggaagagaataagggcaagagttgcgggtggtga

DBGET integrated database retrieval system