KEGG   Sphingorhabdus flavimaris: SPHFLASMR4Y_01857Help
Entry
SPHFLASMR4Y_01857 CDS       T04949                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sfla  Sphingorhabdus flavimaris
Pathway
sfla00620  Pyruvate metabolism
sfla00680  Methane metabolism
sfla01100  Metabolic pathways
sfla01120  Microbial metabolism in diverse environments
sfla01200  Carbon metabolism
Module
sfla_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sfla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPHFLASMR4Y_01857 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    SPHFLASMR4Y_01857 (ppc)
Enzymes [BR:sfla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SPHFLASMR4Y_01857 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase ACT_5 PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ASK88603
UniProt: A0A220W703
LinkDB All DBs
Position
1904099..1906786
Genome map
AA seq 895 aa AA seqDB search
MTESLTVRQNPDIKYLGKLLGDVIRSYGGEDLYRRTEYIRSTSVDRHRGLADADAIDPGL
DALSLDETLAFVRGFMLFSLLANLAEDRQGVAAEKGATVVEAIELLASEGVDRDAILHLL
EDALIAPVLTAHPTEVRRKSIIDHKSRIAELLLMKDEGEEETPQGDMLDAAILRQIALLW
QTRPLRRERLFVTDEVQISQSYMKDVFLPVLPRLYAKWERTLGARLPSFLKLNSWIGGDR
DGNPFVDAGAMEEALSRAAETVIGYYLMCVHTLGAELSISTELADVPEAVLELAEASGDD
SLSRKDEPYRRALSGIYAKLSATHLKLCGHVPGRASTITAEAYDNPQQLREELVILAQGL
KSAGKGVFATSGALGRLIRTVELFGFHLATLDMRQNSKVHERVVAELLKQAGVEDDYLAL
DEAARVKRLRAELANNRPLASPWITYSDETAKELSIIRAAAEAHRKYGPEVITNYNISNG
ESVSDILEVYVLLMETGLYHAPTEDNASPSCPVMAVPLFETVADLENAPQVMTDFFALPE
MHALAKGRGHQEVMIGYSDSNKDGGYLTSTWSLFKASDALTPIFAEAGIKMQLFHGRGGA
VGRGGGSAFGAIKAQPKGTVAGRVRITEQGEVIAAKYGTEDVAEANLEAMTSAVLINSLE
PDRTDDKIQADHAAAMDEISQVAFTEYRDLVYGDDSFRTFFRQMTPLTEIAKLKIGSRPA
SRTTSDKIEDLRAIPWVFSWAQARVMLPGWYGVGQALQAFDDKAKLKDMAQSWPFFQASL
SNMEMVLAKSDMGIAARYAGLVEDQDMGQAFFDRIRSSWYQTRDILLEITDQPHLLAKSP
ALFNSIELRLPYIEPLNHLQIELMKRLRAGEDDPRIGEGIQLSLNAIATALRNSG
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgacagaatccctcaccgtccgccaaaatccagacatcaaatatctcggcaaattgctg
ggcgacgtcatacgttcctatggcggggaggatctttaccggcgtaccgaatatattcgc
tcgaccagcgtcgatcgccatcgcggtctcgccgatgcggatgcgattgatcccggcctt
gatgcgctgtcgctcgacgagacgctcgccttcgtccgcggattcatgctcttttccctg
ctcgccaatcttgccgaggaccggcagggcgtggcggcggaaaaaggcgccacggtggtc
gaggcgatcgaactgctggccagcgagggcgtggaccgggacgcgatcctgcatctgctc
gaagacgcgctgatcgcgccggtgctcaccgcccatccgaccgaagtgcggcgcaagagc
atcatcgaccataaatcccgaattgccgaactgctgctgatgaaggacgagggagaggaa
gaaaccccgcaaggcgacatgctcgacgccgcgatcctgcgccagatcgccctgctctgg
cagacccgtccgctgcgccgcgaacgtctgttcgtcaccgacgaagtgcagatttcgcaa
agctatatgaaagacgtgttcctgcccgtgctgccccggctctatgccaaatgggagcgg
actttgggcgcgcggctgccgagtttcctgaaactcaacagctggatcggcggcgaccgg
gacggcaatccctttgtcgacgccggcgcgatggaggaagccctgtcgcgcgcggcggag
accgttatcggctattatctgatgtgcgttcacactctgggcgccgaactgtcgatctcc
accgaactggccgacgtgcccgaagcggtcctcgaactcgccgaggccagtggcgatgat
tcgctcagtcgcaaggacgagccctatcgccgcgccttgtccggcatctatgcaaaattg
tcggcgacccacctcaagctgtgcggtcatgtgccgggccgcgcgtcgacgattaccgcc
gaggcctatgacaatccgcagcagttacgcgaggaactggtcattctggcgcagggtctc
aagtcggccggcaagggcgtctttgcaacttccggagcgcttggccgcctgatccgcaca
gtcgaactgttcggcttccaccttgccacgcttgatatgcgccagaacagcaaagtgcat
gagcgggttgtagcagaattgctgaaacaggccggcgtcgaagacgattatctggcgctc
gacgaagcggcgcgggtcaagcggctccgcgccgagctggccaataaccgcccgctggca
agcccgtggatcacctatagcgacgagaccgcgaaagaattgtcgatcatccgcgcggct
gccgaagcgcaccggaaatatggccccgaggtcatcaccaattataatatcagcaacggc
gagagcgtttccgatatattggaagtctacgtcctgttgatggaaaccggcctctatcat
gcgcccaccgaagacaatgcttcaccatcctgcccggtcatggcggtgccgcttttcgaa
accgtcgccgatctggaaaatgcgccgcaggtgatgaccgatttctttgccctgcccgag
atgcacgcgctcgcaaaaggtcgtggtcatcaggaagtgatgattggctattccgacagc
aacaaggacggcggctacctgacctcgacctggagcctgttcaaggcgagcgatgcactg
accccgatattcgccgaggcgggcatcaagatgcagctgttccacggacgcggcggtgct
gtgggccgtggcggtggttccgccttcggtgccatcaaggcgcagcccaagggcaccgtc
gccgggcgcgtccggatcaccgaacagggcgaagtgatcgctgccaaatatggtaccgaa
gatgtcgccgaagccaatctggaggcgatgacctcggccgtactgatcaattcgctcgaa
cccgaccggaccgacgacaagatacaggccgaccatgccgctgcgatggacgaaatctcg
caagtcgcgttcaccgaatatcgcgatcttgtctatggcgacgacagcttccggaccttt
ttccggcagatgacaccgctgacggaaatcgccaaactgaagatcggctcgcgacccgcc
agccgcacgacaagcgacaagatcgaggatctgcgcgccatcccctgggtattcagctgg
gcacaggcccgggtgatgctgcccggctggtatggtgtcggacaggcgctacaggccttt
gacgacaaggcgaagctgaaggatatggcgcaaagctggcccttttttcaggcctcgctc
tccaacatggaaatggtgctggccaagtccgatatgggtattgccgcccgctatgccggg
ctggtcgaggatcaggacatgggccaggcatttttcgaccgtatccgctcgagctggtac
cagacgcgcgacatattgcttgaaattaccgatcagccccatctgctggcgaaaagcccg
gcgctgttcaacagtatcgagttgcgcctgccctatatcgaaccactcaaccatctccag
atcgaactgatgaagcggctgcgcgccggggaagatgatccacgtatcggcgaagggatc
cagctgtcgctcaacgccatcgccaccgcgctacgcaacagcggctga

DBGET integrated database retrieval system