KEGG   Sphingorhabdus sp. SMR4y: SPHFLASMR4Y_02220Help
Entry
SPHFLASMR4Y_02220 CDS       T04949                                 

Definition
(GenBank) D-glucose-1-phosphatase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
sfla  Sphingorhabdus sp. SMR4y
Pathway
sfla00361  Chlorocyclohexane and chlorobenzene degradation
sfla00625  Chloroalkane and chloroalkene degradation
sfla01100  Metabolic pathways
sfla01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfla00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPHFLASMR4Y_02220
   00361 Chlorocyclohexane and chlorobenzene degradation
    SPHFLASMR4Y_02220
Enzymes [BR:sfla01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     SPHFLASMR4Y_02220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ASK88964
UniProt: A0A220W831
LinkDB All DBs
Position
complement(2266186..2266737)
Genome map
AA seq 183 aa AA seqDB search
MRCLFEKLIDDPIELDWFLTHVVTPEWHFQHDAGRPFADMVAERSREFPAYRDHIIAYSE
RFPETIPGPVEGMLDIVRALAERGVPLFAISNFGAESWAQFRPSAPIFDIFTDIVISGEE
KLIKPDPAIFDLALQRFDRRAGQCLFIDDRTDNIAAGEALGIAGHHFSDVATFERALKAY
GLL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
ttgcgctgtctgtttgaaaaactgattgacgatccgatagagctggactggtttctgact
catgttgtcacgccggaatggcatttccagcatgacgccggaagacccttcgccgacatg
gttgccgaacgcagccgcgaatttcccgcctatcgcgatcatatcattgcctattccgag
cgctttccggaaaccattcccggaccggtcgaaggcatgctggatatcgtccgggccttg
gcggagcgtggcgtaccgcttttcgcgatcagcaatttcggcgccgaatcctgggcccag
ttccggccctcggccccgatattcgacatattcaccgatatcgtcatttccggcgaagaa
aagctgatcaagccggacccggccatattcgatctggcgctgcagcgctttgaccggcgc
gccggtcaatgcctgttcatcgacgaccggacggacaatattgccgccggcgaggcgctg
ggaattgccggccaccatttcagcgatgtcgcaaccttcgagcgggcgctgaaggcctac
ggcctgctctag

DBGET integrated database retrieval system