KEGG   Scleropages formosus (Asian bonytongue): 108918060Help
Entry
108918060         CDS       T04919                                 

Gene name
msh6
Definition
(RefSeq) DNA mismatch repair protein Msh6
  KO
K08737  DNA mismatch repair protein MSH6
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    108918060 (msh6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108918060 (msh6)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     108918060 (msh6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MutS_V MutS_III MutS_I PWWP MutS_IV MutS_II
Motif
Other DBs
NCBI-GeneID: 108918060
NCBI-ProteinID: XP_018580482
UniProt: A0A1W4XM35
LinkDB All DBs
Position
8
AA seq 1377 aa AA seqDB search
MSKQSSIFSFFSKSPPLVSKVKPSPSPTEADLPSSTGKSNCSPKEEAKLRAPQNTKKPLE
KLNRTPAKGGISNLFTDKKHSTKESPSCAFSAGALVWAKLEGHPWWPCMVVPQPLTGQQM
RGHGRKQRLHVHFFDKPPTRGWVSVRYVKEYQGSNSPDAKSGGMFFSGKPVIRQAMELAD
KALADSPEKRLKMTVCTDPSDEEEEEEEMEVDKSTITDEELTGEEEGVEIKAKASRCSTR
SRQGGEQKPKRRRIVVASDSEGSDEEFKPDQAGSSSEEEEDVSSGVDEEEEVSEPESEPD
SPVKPVKRKRPSEKPPKAKSTPAPSESPKSALASLSSVSAKTKSKLSAFCAPESFESQGN
STGGFVGGGNVWDHEKLEWLQDGKRKDAKRRRQSDEDYDPTTLYMPEDFLNRSTPGMRRW
WQLKSEMFDTVIFYKVGKFYELYHMDAVIGFNELGLTFMKGTWAHSGFPEIGFSRFSDVL
VQRGYKVARVEQTETPEMMEARCKTMVRPTKFDRVVRREVCRIITRGTQTYSVLDGAPSE
TQSKYLLSVKEKAGEDSSGCQRTYGVCFVDTSVGRFCVGQFQDDRHCSRFRTLVAHFPPT
QVLFERSGLSAETRKLLKSSLSSALQEGLVPGTQFWDAPKTLKVLSEEDYFTESGSKSGG
TAGEFLPSVLKAMTSGSDSLGLTPGEGYELALSALGGCVFYLKKCLIDQELLSMANFEEY
VPVDVEIEKTAGPASFFAQTRQRMVLDGVTLANLEILQNNSTGGLEGTLLERLDSCCTPF
GKRLLKQWLCAPLCNPSSIKDRLDALEDLMGVPAQTSEIVELLKKLPDLERLLSKIHSMG
TPLKGQDHPDSRAVLYEEITYSKRKIADFLSALEGFKTMQQIVSVLGAVAEGFRSKLLCQ
VVLKKTDSEEGLFPDLSGELKRWDTAFDHQKARNTGVITPKSGFDPEYDQALAGIKESEQ
AFQEYLDRQKKRLGCKSLTYWGTGRNRYQMEVPDSVSDRNIPEEYEVKSTRKGWKRYWTR
EIERLFSELQGWEEKRDAALKDCMRRLFYNFDKNYRDWQTAVECMAVVDVLLSLSRYSQG
GDGPMSRPEVLLPSDTPGSTPFLDLRGSCHPCVSKTFFGDDFIPNDIAIGCTGTQDEDEE
RGEASCVLVTGPNMGGKSTLMRQCGLVVILAQLGCYVPAESLRLTPVDRIFTRLGASDRI
MAGESTFFVELSETASILHHGTRHSLVLLDELGRGTATYDGTAIASAVVKELAEHIHCRT
LFSTHYHSLVDDHAQDPAVRLGHMACMVENECEDPSQETITFLYKFIPGACPKSYGFNAA
RLARIPEEVIQLGHKKAREFERSTIALRVFKQLCAFADNCKADTGRFIALVRKMGEI
NT seq 4134 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagcaaagcagcattttcagttttttctctaaatctccgcctctcgtttcaaaa
gtaaaacctagcccatctccgaccgaggcagacttgccgtcatcgaccggtaaatccaac
tgttccccgaaagaagaagcaaagctaagagcaccacagaacactaaaaagccgctggag
aaactgaacagaacaccggctaaaggaggcatcagcaaccttttcaccgacaaaaagcac
tctactaaagaaagtccatcatgtgccttcagtgccggagctttagtgtgggccaagctg
gaagggcacccctggtggccatgcatggtggtgccccagcccctgactggacagcaaatg
cgtggccacggccggaagcagcgcctacacgtccacttctttgacaagcctccaacacgg
ggctgggtcagtgtccggtacgtcaaggagtatcaaggatccaacagccctgatgcaaag
agcggaggcatgttcttcagtgggaaaccagtgattcgccaggcgatggaactggcggac
aaagctcttgctgacagcccagagaagaggctgaagatgacggtctgcacagatccctct
gatgaagaggaggaagaagaagaaatggaggtagataagtccacaataacagatgaagag
ctgactggggaggaggagggagtagaaattaaggcaaaagccagtagatgttccaccagg
agcagacaggggggagagcagaagcccaagagacgtcggattgtggtggcatctgatagc
gaaggctccgatgaggaattcaagccagaccaggctggtagcagcagtgaggaagaggaa
gatgtcagcagtggggtggatgaggaggaagaagtgagtgagccagaatctgagccagat
agtcctgtcaagcctgtaaagcgaaaacggccatctgagaaaccgccaaaggctaaatct
acccctgcgccatcagaatcccccaaaagtgccttggctagtctctcctccgtctcagcc
aaaacaaagtccaagttgtcagctttctgtgctccagagagctttgagagccaggggaat
agcacagggggatttgtgggtggaggaaatgtttgggaccacgagaagcttgagtggctg
caggatggcaagaggaaggatgccaaaaggcggcgacagtctgatgaggattatgacccc
acaaccctttacatgccagaggactttctgaacaggtctacacctggaatgcggcgctgg
tggcagctcaagtcagagatgtttgacacagtcatcttctacaaggtgggcaagttctac
gagctctaccacatggatgcagtgataggattcaatgagctgggcctcaccttcatgaaa
ggcacctgggcacactctggctttcctgagattggtttctcccgcttctctgatgtcctt
gtgcagaggggctacaaggtagctcgtgtggagcagacagagacaccagagatgatggag
gcacgctgcaagaccatggtacggcctacaaaatttgaccgtgtggtacggcgggaggtc
tgccggattatcacacggggcacacagacgtacagtgtgctggacggtgccccctctgag
acccagagcaagtacctcctcagtgtgaaggagaaggctggggaggatagctcaggctgc
cagcgcacttacggagtgtgctttgtggacacctctgtgggccgcttttgtgtaggccag
ttccaggacgaccgccactgctctcgcttccgcacgctggtagcacactttcctcccact
caggtgctctttgagaggagtggcctctctgctgagacacgcaaactgctgaagtcctcc
ctgtcctcagccctgcaggaggggcttgtacctgggacccaattttgggatgctcccaaa
acccttaaggtgctgtcggaggaggactattttacagaaagtgggtcaaaaagtggaggg
acagctggtgagttcctcccatcagtgctcaaggccatgacatctggaagtgactcactg
ggcctcacacctggtgagggctatgagctggccctctctgccttgggtggctgtgtcttc
tatttgaagaaatgcctgattgaccaggaattgctctcgatggccaattttgaggagtat
gtccctgtggacgtggagatcgagaagacagctggcccagccagcttctttgctcagaca
cgccagcgcatggttctggatggggtgactctggccaacctggaaatccttcagaataat
tccacagggggtttggaggggaccctgctcgaacgcctggactcttgttgcacccctttt
ggcaagcggctgctgaagcagtggctctgtgccccactctgcaatccttcctcaatcaag
gatcgacttgatgccctagaagacctgatgggtgtaccagctcaaaccagtgagattgta
gagctgctgaagaaacttccagacctggagagacttctgagtaagatccacagcatgggg
acccctctgaaaggccaggaccaccctgacagccgtgcagttctgtacgaagagatcacc
tacagcaagcgcaagattgccgacttcttatcagcactagagggctttaagaccatgcaa
cagattgtgtcagtcttgggagcagtggctgagggcttccggtctaaactgctttgccag
gtggtgctcaagaagactgatagtgaagaaggcctcttcccagacctttctggggagctc
aagcggtgggacacggcctttgatcaccagaaggcccgcaacactggtgtcataaccccc
aagagtggctttgacccagagtatgaccaggcgctggctggaatcaaggaaagcgagcag
gcctttcaggagtacctggatcggcagaagaagcggctgggctgtaagagcctgacgtac
tggggcactggtcgaaaccgctatcagatggaggtgcctgatagtgtgtcagaccgcaac
atcccagaggagtatgaagtaaagtccactaggaagggctggaagcggtactggacacgg
gagattgagcggctcttttcagagctacagggctgggaggagaagagggatgctgcgctc
aaggactgcatgcgcagactcttttacaacttcgacaagaattacagagactggcaaaca
gcagtggagtgcatggctgtagtggatgtgctgctgagcctgtcccggtacagccaaggc
ggtgatgggcccatgagccggcctgaagtgttgcttccatcagacactcctgggtccaca
cctttcctggacctcaggggatcctgccacccctgtgtctccaagaccttttttggtgat
gacttcatccccaatgacattgctattggctgcactggcactcaggatgaagatgaagag
aggggagaggcatcctgtgtacttgttactgggccaaacatggggggcaagtccaccctg
atgaggcagtgtgggctggtggtgatcctagcgcaattgggctgttacgtgccagcagaa
agcttgcgcctgacccctgtggacaggatctttacccggttgggtgcttcagaccgcatc
atggcaggtgaaagcactttctttgtagagctgagtgagacagccagcatcctgcaccat
ggcaccagacattctttggtgctcctggatgaactaggtaggggcaccgccacatacgac
ggcacagcaattgccagtgcggtggtaaaggagctggccgaacacattcactgccgcaca
ctcttctctacccactaccattccctagtggacgaccatgcccaggaccctgccgtgagg
ctgggtcacatggcatgcatggtggagaacgaatgtgaggatcccagccaggagaccatc
actttcctctacaagttcattccgggagcatgccccaaaagctacgggtttaatgccgcc
cggttggcccgcatcccagaggaggttattcagttgggacacaagaaggccagggagttt
gagaggagcaccattgcccttcgggttttcaagcaactctgtgcatttgctgacaactgc
aaggctgacactggacgtttcatcgcattggttcggaagatgggtgaaatctga

DBGET integrated database retrieval system