KEGG   Scleropages formosus (Asian bonytongue): 108918214
Entry
108918214         CDS       T04919                                 

Definition
(RefSeq) NF-kappa-B essential modulator-like isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04010  MAPK signaling pathway
sfm04210  Apoptosis
sfm04620  Toll-like receptor signaling pathway
sfm04621  NOD-like receptor signaling pathway
sfm04622  RIG-I-like receptor signaling pathway
sfm04623  Cytosolic DNA-sensing pathway
sfm04625  C-type lectin receptor signaling pathway
sfm04920  Adipocytokine signaling pathway
sfm05132  Salmonella infection
sfm05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108918214
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108918214
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108918214
   04621 NOD-like receptor signaling pathway
    108918214
   04622 RIG-I-like receptor signaling pathway
    108918214
   04623 Cytosolic DNA-sensing pathway
    108918214
   04625 C-type lectin receptor signaling pathway
    108918214
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108918214
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108918214
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108918214
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfm01001]
    108918214
Protein kinases [BR:sfm01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   108918214
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10
Other DBs
NCBI-GeneID: 108918214
NCBI-ProteinID: XP_029103798
LinkDB
Position
22
AA seq 632 aa
MVQPQAQAGSALKWEMAGGEGIGVGSQGSLRVPPDLADSEAVNRLLGDNHQLREALRRSN
VALKERCEEMEEWQQRSRKEREFLSCRFQEARALVERLSEENHALLAKLNHTGAHTNGRS
MRKEQNSIGTQINDLPLALDMSKNKGETELKDLENATDRQTPPSSLLSSSQCGKADSSIC
SFISSVFPSLSGSLTSAEGEVCGKAEGEACSKPIDGANEFLKLLKSHKEKLEENLQEFRI
KNKELERKREEVEEERDCLRNANAQLQLELSQIQGGGVLKDMLQRSDSQASNSESAHLAS
LVEELQIAQARYKELVEKYDSLQKSTAQRDKSEARLKQKDKDFGQMTKDSEALKSQVTSL
LGELQERQTCLENSEKERERLQERLSTKTEALQFAERELEQLKKQHSVTVDQLRLQTENL
ETALKTERHFLTEEKRKLAQLQRAYTQLFQDYDTKLKNESQVKQRGGEVEDLACRLEEAE
RALALKQDLIDKLKEEVEQQRTSLETIPVLTAQAEIFKADFLAEREAREKLNQRKEELQE
QLNKTLAELDRMKQEGTSRARMEVMQQRHLEDFQSGRPPQAGMFAGATVPFSPSSFRRQS
MSEELPDFRCPKCQYQAPEMDTLQIHVMDCIQ
NT seq 1899 nt   +upstreamnt  +downstreamnt
atggttcagccacaggctcaagctggtagtgcactgaagtgggagatggcaggcggagag
gggatcggggttggcagtcaagggtccctccgggtaccgcctgatttggcagacagtgag
gctgtgaacaggctccttggggacaatcatcagctaagagaggccttgaggcgcagtaat
gtggctctcaaggaaagatgtgaggagatggaagagtggcagcagaggtcacggaaggag
agagagttcctcagctgccgctttcaggaggccagggctcttgtcgaaagactttctgaa
gaaaaccatgcacttctagcaaagctgaaccacacaggtgctcacacgaatggaagaagc
atgagaaaggagcagaactcgattggcacacagataaatgacctccctctcgctcttgat
atgtcaaagaataagggagaaacggaactgaaggacttggagaatgcaacagacagacag
actcccccaagcagtttgctgtcttcatctcagtgcggcaaagccgactcaagtatttgt
agcttcatcagtagtgtcttcccaagcctatctggcagtttaacatcagctgaaggggag
gtctgtggaaaggcagagggtgaggcctgcagcaagcccattgatggtgccaatgagttc
ttaaagctgctgaagagccataaagaaaagctagaggagaacctgcaggaattcaggatt
aaaaacaaggagctggagaggaagagagaagaggttgaggaagaacgagattgcctgcgc
aatgctaatgcacaactgcagttagagctctctcagatacagggtggaggtgtattgaag
gatatgcttcaacggtcagactcacaggcttccaactctgaaagtgcccatttggccagt
ctggtagaggagctgcagattgcccaggccaggtataaagaacttgtcgagaaatatgac
tctctccagaaaagtacagctcaacgagataaaagtgaagcgcgactgaagcagaaggac
aaagattttggacagatgaccaaagatagtgaagcgctcaagtcccaggttacttctttg
ttaggggagctgcaggagagacaaacatgtctggaaaacagtgagaaagaaagggaaaga
ctgcaagaaagactctctactaagacagaggccctgcagtttgccgaaagggagctggag
cagttgaagaagcagcacagtgtgacagtggaccaactgcggctgcagacagagaacctg
gaaacagctcttaagacggagaggcatttcctcacagaggagaagagaaagctggctcag
ttacaacgtgcttatacacaattattccaggactatgatacaaagcttaaaaatgagagt
caagtcaaacaaaggggtggtgaggtggaggacctggcatgcagactggaggaggcagaa
agagctctggctctgaaacaggacctcattgacaagcttaaggaagaggtggagcagcag
agaacgtctctggaaaccattcctgttctcactgcccaggcagaaatattcaaagcagac
ttcctagcagagagagaggccagggagaagctgaaccagcgcaaagaggagctgcaagag
cagctgaataagaccctggctgagctggacaggatgaaacaggagggcacatcaagagca
cgcatggaggtgatgcagcagagacacctagaggacttccagtctggtcgaccccctcaa
gcaggaatgtttgcgggagcaacagtgccattcagtccctcatccttccggaggcaaagt
atgtcagaggagctgcctgacttccgctgcccaaagtgccagtatcaggcaccagagatg
gacaccttgcagatccacgtcatggactgcatccagtga

DBGET integrated database retrieval system