KEGG   Scleropages formosus (Asian bonytongue): 108918353
Entry
108918353         CDS       T04919                                 

Gene name
smug1
Definition
(RefSeq) single-strand selective monofunctional uracil DNA glycosylase
  KO
K10800  single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    108918353 (smug1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108918353 (smug1)
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     108918353 (smug1)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     108918353 (smug1)
 Prokaryotic type
     108918353 (smug1)
SSDB
Motif
Pfam: DUF4918 UDG NAD_binding_7
Other DBs
NCBI-GeneID: 108918353
NCBI-ProteinID: XP_018581006
LinkDB
Position
22
AA seq 283 aa
MYESEPGRLPMQDVSVDTEVAEDRSRLPGPHAQVPNGSDIALQFLQVELELNAHLRRLVF
QEPVRYTYNPLEYAWETHRCYVNTYCHEGQSVLFLGMNPGPFGMAQTGVPFGEVKSVRDW
LKISGEVGHPPEEHPKRRILGLSCTQSEVSGTRFWGLFRKLCGEPAVFFRHCFVHNLCPL
IFMTSSGKNLTPPELPPSERDALLALCDEALCQVVRTLGIAMVVGVGKVAEQRARRALVA
AGIEVRVVGLMHPSPRSAQANRGWESLAMARLKELGILELLTP
NT seq 852 nt   +upstreamnt  +downstreamnt
atgtacgaaagcgaaccggggaggctgccaatgcaagatgtcagtgtggacacggaggtg
gcagaggaccgcagtaggctgcctgggccccatgcccaagtaccaaatggctcagacata
gccttgcagtttttgcaggtggagctagagctgaatgcccacttgaggagacttgtgttc
caggagcctgtgcgttacacatataatccgctggagtatgcctgggagacgcaccgttgc
tacgttaacacctactgccatgaggggcaaagcgtcttgttcctgggcatgaaccctggg
ccctttggcatggcacagacaggggtaccttttggagaagttaaatctgtccgtgactgg
ctaaaaatctctggggaggttggccatccacctgaagagcatccaaagcggagaattctc
ggtctttcatgcacgcagagtgaagtgagcggcacacgcttctggggactcttccgcaag
ctgtgtggagaacctgctgtgttcttccgccactgctttgtgcacaacctgtgccctctc
atcttcatgaccagcagtgggaagaacctgacaccacctgagctgccgcccagtgagcgg
gatgcgctgttggccctgtgcgacgaggccctctgtcaggtggtgcggacattgggcatt
gccatggtagttggggtggggaaggtggcagagcagcgagctcgacgtgccctggtagca
gctggcatagaggtgcgtgtggtgggtctcatgcacccctcccctcgcagcgcacaggct
aatcggggctgggaaagcctggccatggccaggttgaaagaattaggcattctggaacta
ctgactccataa

DBGET integrated database retrieval system