KEGG   Scleropages formosus (Asian bonytongue): 108918444Help
Entry
108918444         CDS       T04919                                 

Definition
(RefSeq) fibronectin-like isoform X1
  KO
K05717  fibronectin 1
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04510  Focal adhesion
sfm04512  ECM-receptor interaction
sfm04810  Regulation of actin cytoskeleton
sfm04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108918444
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108918444
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108918444
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108918444
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sfm04131]
    108918444
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfm04147]
    108918444
   00536 Glycosaminoglycan binding proteins [BR:sfm00536]
    108918444
Membrane trafficking [BR:sfm04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    108918444
Exosome [BR:sfm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   108918444
Glycosaminoglycan binding proteins [BR:sfm00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   108918444
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 fn1 fn2 Pur_ac_phosph_N DUF2369 Interfer-bind MG4
Motif
Other DBs
NCBI-GeneID: 108918444
NCBI-ProteinID: XP_018581196
LinkDB All DBs
Position
14
AA seq 2474 aa AA seqDB search
MPRGVWSALLLALCVGSWVHCMPRTKSRRQALERVKTALEDGSSASQDGCVDKDRYFRVN
EQWERAHLSGTLLCTCHGAAGIKCKSKPEAEETCYDKVIARSYRVGETYERPKDGMIWDC
TCIGSGRGKISCTIANRCHEGGNSYKIGDTWRRPHDTGGYMLECVCLGNGKGEWTCKPLA
ERCYDNAAGVSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRSSYRIG
DTWTKTDARGHRLQCLCTGNGRGEWKCERHASLHTSVLGTGSRLTNVQEAVYRPVPHPEP
PAEGTCVTESGMTYFLGMRWIRTQGSKEMLCTCLGNGISCEEWEGHSQVYGGNSGGKPCV
FPFVFMGKTYYSCTSDGRADGQLWCSTSSDYETNHEYSFCTEKNVLVTTRGGNSNGALCH
FPFLYSGRNYTDCTSDGRHDSMKWCGTTYNYDREQRFGFCPMAAHEEVCTTSEGIMYRVG
DQWDKRHDVLGHMMRCTCVGNGRGEWSCIAYSQLKDECIVDGLTYEVNQTFTKRHDEGYM
MNCTCFGEGRGRWKCDAIDQCQEPETRVFYQIGESWDKIIHGTPYRCYCYGNGIGELNCE
PQQPYSGGHRPVQVIITESANQPNSHPIQWNAPPSAHVTQYILKWRQKDTRAPWKQVTIP
GHLNSYTIAGLKPGITYEGQLISILRYGRRELTRFDFTTTYGSLATTEGETTPPPPVVDI
SESVTEITSSSFVVSWVSASDTVSGFRVEYELNEEGATPIVLDLPRTATSVNIDKLLPGR
KYILNVYEVPVEGEPTLILTTSQTTAPDAPSEHEVGEVEETSIMISWTKPEAPITGYRVV
YTPSMEGGSTELNLPDTATSVTLSDLRPGLLYNVSIYAVEENLESEPVFVQVTTAGEPLP
EEVPPPTDLQFYEVSDMKIIIMWTAPNSEVHGYRVSVSPLGPRGDNDEDFDLPVTRNAYA
EVTPLKPGTLYRFYVYTINRGVESEPLVGEQATKPDAPTNLQFSNITEQSVLIIWGAPRA
LISGYRLFVSTEGSNPKQQRIPARRSQYTLLNLRPDTQYTVTLHSEKDNVLSEGVSTTFI
TAQPLGNAPRFTTDVSSTSIVISWTPVPKIAYKLTVRPSQGGEAPRDVISDSGTAYITGL
TPGVEYTYSIQPVINGQEQGTPITRRVVMPLSPPTDLSVTTSPATGKLTVQWVDSETPDI
TGYRVTYAPTSGQQGDSLEEFVSPDQTYYSLENLRPGIEYNISVYTVKDGTESVPVSTTV
TPDVPQITDVDFVEVTGTSIGLRWNPLNYTAITGYRITVVAAGESVPIFEEMVGPATGYY
TVHGLEPSVNYEISVTTVTESGESEPTTNTQQTAVPAPTNLQFGEVGPDSMEVSWTAPVV
PKPRDISRFVVRYHPSNNDDNIMERNVGGNTKSILLQDLLPNTEYLVSVVCVYEERESIP
VSGTQKTAVDSPTGLDFSDVSTNSFTVHWLAPRAFLTGYRIRYQMASGGRTKDERLPPSR
NHFTLTGLASETEYIIHIYAVSGSEESLPLIGRQATISDAPTDLEVVSSTPTSISIHWNA
PPATVRYYRITYGETGGESTPKEFTIPGTQSTATIQNLRPGTAYTVTVYAVTGRGDSPAS
STPIHITYRTDIESPSEMEVTNVEDNSITVRWTPAEGPVTGYRITGTPKNGQGPSFSEVV
APDQTEITFSGLMPTSEYELSVYSLGQDVESTPLVETAVTTVDRPKGLTFSHVETTSLRI
SWESPDGVVTSYRVLYSSPEEEEHELHPAPHGEDETAELHGLHPGTEYTVKVIAIHDRTP
SLPLIGTQATAIPAPTDLEFSQVGPTTFTITWKAPTAQLSGYRVVINPKSRTGPPKELNL
APDTTQVVVPGLMVATAYEVQVYALKNSITSRPLHGEVTTLQHISPPRRVRIIDTNDSTI
TLTWRSKTETITGFLIQAKPMNGGHAPIQKTIPPSEPSYTITGLLPDTPYTIHIYTLNGN
ARSAPFTLTVTTGKPAVEPPTNIHFTSLTPNSITFSWEPPRTRITGYYITYEESNGTPRE
LIPRLHAGMSHATISGLKPGTEYIIKIIALQNARRSTPLVGRARTQEDVQLLVPQLPIPH
HRGPDVLDVPQVLPAFEDNSVQLMGTSGQNTLDQQGQYVYTEYQSLGNNGQGEPLGGHTS
IPLVYVPQAGPDGVRVPVVRVNEEPSLGFPFGFPENDTGLPQEALTQTTISWEPLQHSSA
YEVFCHPITNSNEKMFQMRLPGTSTSATLIGLTSGASYNVIVEALKGNLRHRVLEEIITA
GSTVPGGLPSNRDMCYDTFTATYHEVGAEWERMSEMGFKLWCKCLGLGSGHFRCDSSRWC
HDNGNNYHIGEKWERQSENGHTMSCTCLGNGKGEFKCEPHESTCYDDGKMYRVGDQWQKE
YLGSICTCTCFGGQQGWRCENCQRPGANIDTSLSQPLSPDILDRYRVNTLRKNIQCPIEC
LTRDLLADAQNPQE
NT seq 7425 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtggggtgtggtcagcgctcctcttagcgctttgcgtgggcagctgggtccac
tgcatgcccaggaccaagagccggcggcaggcgctcgagagggtgaagacagccctggag
gacggctcgtccgcgtcccaagatggctgtgtcgataaagatcggtatttccgcgtgaac
gagcaatgggagcgcgcccacctgagcggcaccctgctgtgcacgtgccacggagccgct
gggatcaaatgcaaatccaagcctgaagccgaagaaacctgctacgacaaggtgatcgcg
cgctcataccgggtgggcgagacgtacgagcggcccaaggatgggatgatctgggattgc
acatgtatcggctccggccggggcaagatcagctgtaccatcgccaaccgctgtcatgag
ggcggaaactcctacaagatcggggacacatggaggcgaccccacgacaccgggggctac
atgctggagtgcgtctgcttaggcaacggcaagggggagtggacctgcaaaccgctggct
gagcgttgctatgacaacgcagcaggcgtgtcctacgtggtgggtgagacctgggagaag
ccgtaccagggatggatgatggtggactgtacctgcttgggcgagggcagcggacgcatc
acctgcacgtcaagaaaccgctgcaatgaccaggacacacgctcctcctaccgcattggg
gacacatggaccaagacggatgcccgcggccacaggctgcagtgtctatgcacagggaac
gggcgtggcgagtggaagtgtgagcggcatgcatccctccacaccagcgtcctgggcact
ggctctcggctgaccaacgttcaggaggcagtatacagacccgtgccccacccagagccc
cctgcagagggaacctgtgtgaccgaatctggcatgacctacttcctgggcatgcgctgg
atcaggacccagggtagcaaggaaatgctgtgcacctgcctgggcaacgggatcagctgc
gaagagtgggagggccactcccaggtgtatggaggcaactcggggggcaagccctgcgtg
ttccccttcgtgttcatggggaagacctactactcttgcacctccgatgggcgtgcagat
gggcagctgtggtgcagcacctcctctgactatgagaccaaccacgagtactccttctgt
acagagaagaatgtactggtgaccacaagaggaggcaactccaatggggctctgtgccac
ttccccttcttgtacagtggacgcaactacacagactgcacatcagatgggcgccacgac
agcatgaagtggtgcggcactacctacaactatgacagagaacagcgattcggcttctgc
cccatggctgctcacgaagaagtgtgcaccaccagtgagggtataatgtaccgtgtgggt
gaccagtgggacaaacgacatgatgtgctgggccatatgatgcgctgcacgtgtgtgggc
aatggccgtggagagtggagctgtatcgcctattcccagctgaaagatgagtgcattgtg
gatggccttacctacgaagtgaaccagacctttaccaaaaggcacgacgagggctacatg
atgaactgtacctgcttcggagagggccgtggacgctggaaatgcgacgccattgatcag
tgtcaggagccagagactagagtcttctaccaaatcggagagtcctgggacaaaatcatc
cacggaacaccctaccggtgctattgctatggcaatggcatcggcgagctgaactgtgaa
ccccagcagccctactcaggtggccaccggcccgtccaggtcatcatcacagagtctgca
aaccagcccaattcccaccccatccaatggaacgccccaccgtcagcccatgtcacccag
tacatccttaagtggagacaaaaggacacccgtgctccctggaagcaggttaccattcca
ggccacctcaactcttacacaatcgctgggttgaagccaggtatcacatatgagggtcaa
ctaatcagcatcctgcgatatggacggcgtgagctcacccgctttgacttcaccacaact
tatggttccctggcaaccactgagggtgaaaccacgcctccaccccccgtggtggatatc
tcggagtctgtgacagagatcacctccagcagctttgttgtgtcctgggtgtctgcttcg
gacacggtgtcaggattccgcgtggaatatgagctgaatgaggagggagcaacacccatc
gtcttggacctacctcgcacggccacatctgttaatattgacaagctgttgcctggtcgc
aaatacatcttgaatgtgtatgaagtaccagttgagggggagcccaccctcatcctgacc
acctctcagactaccgctcctgatgctccatctgaacacgaggttggcgaagtggaagag
acttccatcatgatcagctggaccaaacccgaggcaccaatcacagggtaccgtgtagtc
tatacaccatctatggagggtggcagcactgagctcaacctgccggacactgccacctca
gtgaccctgagcgacctgcggcccggcctgctgtacaatgtcagcatctatgccgtggag
gagaacttggagagcgagccagtgttcgttcaggtcaccactgctggcgagccgctgcca
gaggaagtcccacctccaacagaccttcagttctacgaagtgtccgacatgaagatcata
atcatgtggacggccccaaatagcgaggtgcatgggtaccgtgtgtccgtctcccccctg
ggtccccgcggtgacaatgacgaggattttgatctgcctgttacacggaatgcatacgca
gaagtcacacccctcaaacccgggactctgtaccgcttctacgtgtacacaatcaacaga
ggggtggagagcgagccactggttggcgaacaggccactaagcctgatgctcccaccaac
cttcagttcagcaacatcaccgagcagagtgtcctgatcatatggggagcacccagggct
ctcatctcaggctatcgcctctttgtgagcactgagggctcgaaccccaagcagcagagg
atccctgctcgccgctcccagtacactctgctgaacctgcgacccgacacccagtacaca
gtcacactgcactcagagaaggataacgtgctcagcgagggcgtgagcaccaccttcatc
accgctcaaccactcggaaatgcaccacgctttaccactgacgtctcaagcacctccatc
gtgatctcttggacccctgtgcccaaaattgcatacaagctgactgttaggccaagccaa
ggtggggaggcccccagggatgtgatctcagacagcggcacagcctacatcacagggctg
actcctggggtagagtacacctacagcatccagccggtcatcaacggccaggagcagggc
acacccatcactcgccgtgtggtcatgcccctgtctccccccaccgacctcagtgtgaca
accagccccgccactggcaagcttactgtacagtgggtcgattctgagacgcctgacatc
actgggtaccgtgtgacctatgccccaaccagcggccaacagggcgactctctggaggag
tttgtgtcgccggaccagacctactactctctggagaacctgcgcccaggcatcgagtac
aatatcagtgtctacacagtcaaggatggcacggagagcgtgcctgtgtccaccactgtt
accccagatgtgccccagattactgacgtggactttgtggaagtcactggcacatcaatt
ggcctgcgctggaacccactgaactacacagccatcacaggctaccgcatcactgtggtg
gctgctggggaaagtgtgcccatcttcgaagagatggttgggcctgcaacaggatactac
accgtgcatggactggaacccagtgtcaactatgaaatcagtgtcaccacagtcaccgag
agtggagagagcgagcccaccacaaacacacagcagactgctgtccctgccccaaccaac
ctgcagtttggagaggtgggccctgactccatggaggtgagctggactgccccggtagtg
cccaaacccagagatatcagccgctttgttgtccgctaccaccccagcaacaatgacgac
aacatcatggagcgcaacgtcgggggaaacaccaaaagcatccttctgcaggacctactg
ccaaacacagagtacctggtgagcgtggtgtgtgtgtatgaggagcgtgagagcattcct
gtctctggcactcaaaagacagccgtggactctcccaccggcctggacttctcagacgta
tccaccaactccttcaccgtccactggctcgccccccgggccttcctcaccgggtaccgc
atccgctaccagatggccagcggaggacgcaccaaggatgagcggttgccaccatcccgg
aatcacttcactctgactggcttggcttctgagacagagtacatcatccacatctacgct
gtcagtggatctgaggagagcctgcccctgattggccgccaggcaactatctctgatgct
ccaactgatctggaggtagtctcatccacacccaccagcatctccattcactggaacgcc
cccccagccaccgtgcggtactataggatcacttacggcgagacaggaggcgaaagcact
cccaaagagttcaccatccctggaacccagtctactgcaacgatccagaacctacgccct
ggtactgcatacacggtcaccgtttatgcagtgaccggacgaggagatagcccggcctct
agcactcccatccatatcacttacaggacagatatcgagtctccctctgagatggaggta
acaaatgtggaggataattcgattacagtccgttggacccccgctgaaggccctgttact
ggctacaggatcactggtacccctaaaaatggccaaggaccctccttctcagaggtggtt
gctcctgaccagacagagatcaccttctcaggcctgatgcccacatctgaatatgaactg
agtgtgtattctctgggtcaggatgtagagagcacacctctggtggagaccgcagtcacc
actgtggaccgccctaaaggcctgactttctctcatgtggagaccacatctctaaggatc
tcctgggagagccccgatggggtggtgacatcatacagagtgttgtattccagcccagag
gaagaagagcatgagctgcaccctgcaccccatggggaggatgagactgctgagcttcat
ggccttcatcctgggaccgaatacacagtcaaggtcatcgccattcatgatcgcacccca
agtctacctctgattggaacacaggccacagccattcctgctcccactgacctggagttc
tcccaggtgggccccaccaccttcaccatcacctggaaggcccccactgcacaactttct
gggtatcgtgtggtcatcaaccctaagagcaggactggcccccctaaagaactcaacctg
gcccctgacacaacccaagttgtggtgccaggacttatggttgctacagcatacgaggta
caggtctacgctctgaagaactctatcactagccgacctctccatggagaggtcaccacc
ttacagcacatcagcccccctcgtcgggtgcgcatcattgacacaaatgactccaccatc
accctgacttggcgttccaagacggaaaccatcacaggtttcctcattcaagctaagccc
atgaatggtggccatgcgcccatccagaagaccatcccacccagcgaaccctcctacacc
attaccggtttgctgccagacaccccctatacaatccacatctacacacttaatggaaat
gctcgcagcgcccccttcaccctgacagtcaccacaggcaaaccagctgtggaacctcct
acaaacatccacttcacctctttgacccccaactccatcaccttctcttgggaacctcca
cgcactcgcatcactggctactacatcacctacgaggagtctaatggaacccccagggaa
ctcattcctcgccttcatgctggcatgagccacgccaccatctctggtctgaagccaggc
acagaatacattattaagatcattgccttgcagaatgcccggaggagtactcctctggtg
ggaagggctagaactcaagaggatgtgcagctgctggtgcctcagctccctatcccacat
caccgtggccctgatgtcctggatgtgcctcaggtcctgcctgctttcgaggacaacagc
gtgcagctcatgggcaccagcgggcagaacacgctagaccagcagggccaatacgtctac
acagagtaccagagcctgggcaacaatgggcagggcgagccccttgggggccacaccagc
atcccgctggtatacgtcccacaggcgggccccgatggggtgcgcgttcctgtggtgcgt
gtcaatgaggagccctcgttgggctttcctttcggttttccagagaacgacacggggctg
ccccaggaggccctgacccagaccacaatctcctgggagccactgcagcacagctctgca
tacgaggtgttctgccaccccatcaccaacagcaacgagaagatgttccagatgcgtctg
ccaggtacctccactagcgccacgctcattggcctgacctccggggcctcttataacgtc
attgtagaagcgttgaaggggaacctaagacacagggttctggaggagatcattactgca
ggaagtacagttccaggtggcctaccctccaacagagatatgtgctacgacacgttcaca
gccacgtaccacgaggtgggagccgagtgggagcgcatgtccgaaatgggcttcaagctc
tggtgcaagtgtctcggcttgggcagcggacacttcagatgcgattcctccaggtggtgt
cacgacaatggtaacaactatcacattggtgagaaatgggaacggcaatctgagaatggt
cacacaatgagctgcacctgcctcggcaacgggaagggagagttcaagtgtgagccacat
gagtccacctgctacgatgacgggaagatgtaccgtgtgggtgaccagtggcagaaggaa
tacctcggatccatctgcacttgtacctgctttggtggacagcagggctggcgctgtgag
aactgccagcggcctggcgcaaacattgacacatcgctgtcccagccactaagccctgac
atattggatcggtaccgagtcaacaccctgcgcaagaacatccagtgtcccatcgagtgc
ctcacacgagacctcctcgcagatgcacagaacccccaggagtaa

DBGET integrated database retrieval system