KEGG   Scleropages formosus (Asian bonytongue): 108918583Help
Entry
108918583         CDS       T04919                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2-like
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
Enzymes [BR:sfm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     108918583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core ASH
Motif
Other DBs
NCBI-GeneID: 108918583
NCBI-ProteinID: XP_018581535
UniProt: A0A0P7V7K3
LinkDB All DBs
Position
Unknown
AA seq 678 aa AA seqDB search
MDIARCNLECELNNTDHHTDLNGVDRLIVRRGQPFIITLHLNSGGYQPGVDDFRLLAETG
PYSSEKMGTKAIFSPDDSIDDTRWSASVSCSEGDYVSLSICSSPDAPIGRYSLSLEQGDT
VSLGEFVLLFNPWCPRDAVYMDTEEERAEYVLTQDGIIYRGDHKYLQGTPWNFGQFEEGI
LDACLRILDENPKYLRNAQDDCSGRRNPVYVSRVLSAMINCNDDKGVLWGKWSGDYKDGI
SPMYWRGSVEILRNWDTSSCTPVRYGQCWVFAAVACSVSRALGIPCRVITNYLSAHDTNS
NLVIERYIDENGKLVKQSRDMIWNYHCWVEGWMRRPDLLDGYDGWQASDPTPQEKSEGVY
CCGPVPVKAIKEGQIVFKYDAPFVFTEVNADVVTYLQHKDGSVQKFLGTSQVGLCISTKS
KGTDKREDITHLYKYPEGSKEEREAFERAGHQNKLLQQQLQPGLHIKIKVSPEMKKGCDF
DVFAYVTNNTNAAKMCRLMFCSRATSYDGILGDDCGFKDLLNLKLAPGEEKQVPLKLNYC
KYGSTLTKDNLIRLTAILFDYSTKEAILAMRTIVLENPEIKIKVLGEPKVNRKLAAEITV
KNPLPEPLSSCCVFVEGANLTGGRTITETIGSSVAPGADAKVKVYFTPSHSGLRKLLVDF
HSDNLGHVKGYRNVIIGK
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggacatcgcaagatgcaacctggaatgtgagctcaataacacagatcaccacaccgac
ctgaacggggtcgaccggttgattgtgcgacgaggccagcccttcatcattactctacac
ctgaattctgggggctaccagccgggagtcgatgactttcgcctcctcgctgaaacaggc
ccgtactcctccgaaaaaatgggcaccaaggcgatcttcagccctgatgactccatagat
gatactcgctggagtgcttctgtgtcgtgttctgagggagactacgtgtctctgtccatc
tgctcttcccctgatgcccccattggacgctactccctgagcttggagcagggtgacact
gtcagccttggggagtttgtcttgctctttaacccatggtgcccgcgagatgcagtctac
atggatactgaagaagagcgagctgaatatgttttaactcaggatgggatcatttatcgg
ggcgatcataaatatctacagggcacaccatggaactttggacagtttgaagaaggaatt
ttggatgcttgcctgagaattctggatgagaaccccaagtacctccgcaatgcccaggat
gactgctcagggcggaggaaccctgtgtacgtgtccagagtgctgagtgccatgatcaac
tgcaatgatgacaagggggtgttatggggaaagtggtcaggtgactacaaggatggaatc
agtcccatgtactggagaggcagtgttgagatcctccgcaactgggatacctcctcctgc
actccagtacgctatggacagtgctgggtctttgcagctgtggcatgctcagtttccaga
gcactaggaatcccttgtcgagtgatcaccaactacttgtctgctcatgacaccaacagc
aatctggttattgagcgctacatagatgaaaatggaaaacttgtcaagcagtccagagac
atgatatggaactaccactgttgggtagagggctggatgcgacgccctgatctcctcgat
ggctacgatggatggcaagccagtgacccaacaccacaagaaaagagtgagggggtatac
tgttgtggccctgtccctgtgaaagcgatcaaagaaggacagattgtcttcaagtacgat
gctccgtttgtattcacggaggtcaatgctgatgtggtgacatacctgcaacacaaggat
ggtagcgttcagaagttccttggcacttcccaggtgggcctgtgtattagcaccaagagc
aagggtactgacaagagggaggacatcacccatctctacaaatatcctgagggttccaaa
gaagaaagggaagcctttgaacgagccggccaccaaaacaagttactgcaacagcagttg
caaccgggtcttcacattaagatcaaggtgtcaccagaaatgaagaaaggctgcgacttt
gacgtgtttgcctacgtcactaataatacaaatgctgccaagatgtgtcgactcatgttt
tgctcgcgagccacttcatatgatgggatcctgggagatgactgtggtttcaaagacctc
ctaaatctaaagcttgcacctggcgaagagaagcaagttcctctaaagctgaattactgc
aagtatggatccaccctcaccaaagacaacctgattcggctgacagctattcttttcgac
tacagtaccaaagaagccattctagcaatgaggactattgtcttggagaacccagaaatc
aaaatcaaggtacttggggaacccaaagtgaaccgaaagcttgcggctgaaatcactgtg
aaaaaccctcttcccgagccactgtccagttgctgcgtctttgtagaaggagctaacctt
actggcggaagaactatcacagaaacgattggatcatcagttgcgcctggggcggacgcc
aaggtcaaagtgtatttcaccccctcccactctgggctgaggaagttgttggtggatttt
catagtgataatcttggccatgtcaaaggataccgaaatgttatcattggaaagtag

DBGET integrated database retrieval system