KEGG   Scleropages formosus (Asian bonytongue): 108918641
Entry
108918641         CDS       T04919                                 

Definition
(RefSeq) kit ligand-like isoform X1
  KO
K05461  KIT ligand
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04010  MAPK signaling pathway
sfm04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108918641
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    108918641
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sfm04052]
    108918641
Cytokines and growth factors [BR:sfm04052]
 Growth factors
  Growth factors (RTK binding)
   108918641
SSDB
Motif
Pfam: SCF DUF4381 HSBP1
Other DBs
NCBI-GeneID: 108918641
NCBI-ProteinID: XP_018581615
LinkDB
Position
21
AA seq 265 aa
MKKAKIWITACVHLLFYSTFFTSSGGIENIVTDDVNIISLLKQNIPKDYKIAIRHIPKKT
GGSCWVHLNVFHLEESLNALAKKFGNVSTNKDNINIFIEKMRDVRVKIDDLELMMQVFEC
HYTEEKLQTGDYFDYIYDLLKSEPSLNGNEKCLPPSCPTSATSFTTAVSPSKTPRMADCN
TSLPDCSTYEAVKYLPEVVGKSLISLLLILMVGVVFLLYWKIKRGRRQQSPETNIELFTG
TEGVPPPTDMERSEEKSQLNTIEIV
NT seq 798 nt   +upstreamnt  +downstreamnt
atgaagaaggcaaaaatttggataactgcttgtgttcatttgttgttctacagcacgttt
tttacctcttcaggtggaatcgaaaatatcgtaacagatgacgtcaatataatctctctg
ttgaaacagaacattccaaaagattacaagattgccatacgtcacatccctaaaaaaacg
gggggctcgtgttgggttcatcttaatgtttttcatttggaagaaagcttaaatgctctt
gcaaaaaaatttggaaatgtttccaccaacaaggataatattaacatctttattgaaaag
atgcgagatgtgcgggttaagattgatgacctggagctgatgatgcaagtttttgaatgc
cattacacagaagaaaaattgcagacaggggattattttgactacatttatgacctatta
aaatcagaaccttccttaaatggaaatgagaaatgtctccccccttcgtgccccacgtca
gcaacttcattcaccacagcagtgtcacccagtaaaaccccaaggatggcagactgtaat
acttccttgcccgactgcagtacatatgaagcagtaaagtacctgcctgaagtggttggg
aaaagcctcatatccttgcttctcatcctgatggtcggagttgtgttcttgttatactgg
aagataaaacgtggcagaagacagcaatctccagagaccaatattgagctcttcactgga
acagaaggggtccctccaccaacagacatggaaagatcagaggaaaagagtcagctgaac
accatcgaaattgtgtaa

DBGET integrated database retrieval system