KEGG   Scleropages formosus (Asian bonytongue): 108918690Help
Entry
108918690         CDS       T04919                                 

Gene name
pfkl
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, liver type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00010  Glycolysis / Gluconeogenesis
sfm00030  Pentose phosphate pathway
sfm00051  Fructose and mannose metabolism
sfm00052  Galactose metabolism
sfm01100  Metabolic pathways
sfm01200  Carbon metabolism
sfm01230  Biosynthesis of amino acids
sfm03018  RNA degradation
Module
sfm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108918690 (pfkl)
   00030 Pentose phosphate pathway
    108918690 (pfkl)
   00051 Fructose and mannose metabolism
    108918690 (pfkl)
   00052 Galactose metabolism
    108918690 (pfkl)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    108918690 (pfkl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sfm01009]
    108918690 (pfkl)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sfm03019]
    108918690 (pfkl)
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     108918690 (pfkl)
Protein phosphatases and associated proteins [BR:sfm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108918690 (pfkl)
Messenger RNA biogenesis [BR:sfm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     108918690 (pfkl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 108918690
NCBI-ProteinID: XP_018581689
UniProt: A0A1W4XQ56
LinkDB All DBs
Position
Unknown
AA seq 780 aa AA seqDB search
MKHLELEKLQRTGAGRAIAVLTSGGDAQGMNAAVRAVTRMGIYVGAKVYLIYEGYQGLVD
GGDHIRLANWQTVSDIIQLGGTVIGSARCEDFTKREGRLKAAFNLVQRGITNLCVCGGDG
SLTGADVFRSEWPGLLAELVQEKRITKALAQQHAHLNIVGLVGSIDNDFCGTDMTIGADS
ALHRIMEVIDAITTTAQSHQRAFVLEVMGRHCGYLAMVSALASGADWVFIPEAPPEEGWE
DHLCARLEENRSKGSRLNIVIVAEGAIDKHGEPISSSYVKDLVVQRLGYDTRVTVLGHVQ
RGGTPSAFDRVLSSKMGMEAVVALLEATPETEACVIGLSGNQAMHLPLMECVQMTKEVQK
AMNELRFEEAIQLRGKSFENNWNTYKLLAHQKPAQSQSNFSMAILNVGAPAAGMNAVVRS
AVRMGLAKGHKVYTVHDGFGGLAKGLINEASWHDVGGWTGQGGSLLGTKRTLPNSCIEEI
VDNVCKYNIQSLLVIGGFEAYEGVLQLVEARGRYDELCIVMCVVPATISNNVPGTDFSVG
SDTAVNAAMESCDKIKQSASGTKRRVFVVETMGGYCGYLATVAGIAVGADAAYIFEEAFN
IHDLEANVEHLKEKMKNDIQRGLVLRNEKSNPHYTTDFIYNLYSAEGKGIFDCRMNVLGH
LQQGGSPTPFDRNFGTKLGVKAVLWITEKMEKTYRQGRVFANSPETACVIGMTKKVLTFS
PVTELKEHTDFEHRMPKEQWWLNLRLMLRMLAKYHTSFDEYVTGEVEHVTRRTLSIETGF
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacttggagctggagaaactgcagcggacgggcgcgggaagggccatcgccgtg
ctcaccagcggaggagacgcgcaaggtatgaatgcagcggtgcgcgccgtcacccgcatg
gggatatacgttggagccaaagtgtatctcatctatgagggctaccaggggcttgtggac
ggaggtgaccacatcagactggccaactggcagactgtttctgacatcatccagctgggc
ggcacggtgattggcagtgcccgctgtgaagacttcaccaagcgggaggggcgcctgaag
gctgcgttcaacctggtacaacgcgggatcaccaacctgtgtgtgtgcggcggagacggc
agtctcacaggggccgatgtgtttcgcagcgagtggccgggcctgctggccgagctggtg
caggagaagaggatcacaaaggccctggcccagcagcatgcccacctgaacattgtgggt
ctcgtgggctccatcgacaacgacttctgtggcacggacatgaccattggggcagactca
gcactgcaccgcatcatggaggtcatcgacgccatcaccacgacggcgcaaagccaccag
cgcgcatttgttctggaagttatgggccggcactgcgggtacctggccatggtgtcagcg
ctggcgtctggagcagactgggttttcatcccagaggccccaccagaggagggctgggag
gaccacctctgtgcacgcttagaggagaaccgcagcaaggggtcccggctgaacattgtg
atcgtggcagaaggagccatcgacaagcatggcgagcccatctcctccagctacgtgaag
gacctggtggtgcagcggctgggctacgacacgcgggtgactgtgctgggtcacgtccag
agagggggcacgccatctgcctttgacagggtgcttagcagcaagatgggcatggaagct
gtggtggccctgctggaggccacaccggagacagaggcctgtgtcatcggtctgtcagga
aaccaggcgatgcacctgccgctcatggagtgtgtgcagatgactaaggaggtgcagaag
gccatgaatgagctgaggttcgaggaggccatccagctgcgtgggaagagcttcgaaaac
aactggaacacctacaagctgctggcgcatcagaaaccggcgcagtcccagagtaacttc
tcaatggcgatcctcaatgtgggggccccggcagcgggaatgaatgcagtggtgcggtca
gccgtgaggatgggtctggccaagggccacaaggtctacaccgtccacgatggctttgga
ggcctggctaaggggctgatcaatgaggccagctggcacgatgtgggaggatggactggc
caagggggctccttgctggggaccaaacggactctaccgaactcctgcatagaggagatt
gtggacaatgtctgcaagtacaacatccagtcccttctggtgattggcggatttgaggca
tacgaaggggtgctgcagttggtagaagcacgtggtcgctatgacgagctctgcattgtc
atgtgcgtcgtccccgccactatcagcaacaacgtccccggcacggacttcagcgtgggc
tccgacactgccgttaatgccgccatggagagttgtgacaagatcaagcagtctgcttcg
ggtacgaagagacgtgtgtttgtggtggagaccatgggcggatattgcggatacctggct
accgtcgctggcatcgccgtgggagctgacgcagcctacatcttcgaggaggccttcaat
atccacgacctggaggcgaatgtggagcatctcaaggaaaagatgaagaatgacattcag
agaggtctagtgctcagaaacgaaaagtccaacccacattacaccacagacttcatctac
aacctgtactcagctgaagggaagggcatcttcgactgcaggatgaacgtgcttggacac
ttgcagcagggagggtcccccactccctttgacaggaattttggcaccaagctgggtgtg
aaggctgttctgtggatcactgagaagatggagaaaacctacagacagggccgtgtgttt
gccaactcaccggaaacagcgtgcgtgatcggaatgaccaagaaagtgctgacctttagc
cctgtcactgaactgaaggagcacactgattttgaacaccgcatgcccaaggagcagtgg
tggctcaacctgcggctgatgctcaggatgctggccaagtaccacacaagctttgacgag
tatgtaacaggcgaggtggagcacgtgacacgtcggaccctcagcatcgagacgggcttt
tga

DBGET integrated database retrieval system