KEGG   Scleropages formosus (Asian bonytongue): 108918746Help
Entry
108918746         CDS       T04919                                 

Definition
(RefSeq) very-long-chain 3-oxoacyl-CoA reductase-like isoform X1
  KO
K10251  17beta-estradiol 17-dehydrogenase / very-long-chain 3-oxoacyl-CoA reductase [EC:1.1.1.62 1.1.1.330]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00062  Fatty acid elongation
sfm00140  Steroid hormone biosynthesis
sfm01040  Biosynthesis of unsaturated fatty acids
sfm01100  Metabolic pathways
sfm01212  Fatty acid metabolism
Module
sfm_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    108918746
   00140 Steroid hormone biosynthesis
    108918746
   01040 Biosynthesis of unsaturated fatty acids
    108918746
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sfm01004]
    108918746
Enzymes [BR:sfm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     108918746
    1.1.1.330  very-long-chain 3-oxoacyl-CoA reductase
     108918746
Lipid biosynthesis proteins [BR:sfm01004]
 Fatty acid synthase
  Component type
   108918746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 108918746
NCBI-ProteinID: XP_018581764
LinkDB All DBs
Position
21
AA seq 359 aa AA seqDB search
MGVLTGWEAVSRALYAIGLVTALCWGLQLARWCWGGFRVYVLSSFWKTDLRQFGQWAVVT
GATSGIGRAYADELARRGLDLILISRSIEKLHTAAKEIESQYGRQTHVIQVDFTKGPSIY
PIIAEKLQGLEIGILGNVLIPGTKYLCWRQALSCNREQLSWSLCAVNNVGMNYAGMLVYF
LDVPDPEKSITDVINCNMLSVAQMTRLVLPHMLERHKGLIINISSEAGSQPQPMLALYSA
TKVFVTYLSRSLTAEYRMQGITVQCVTPCVVSTNMTHNVEVGPLVKSASAFAYEALNTVG
YSNYTSGCLLHALQHIALCIFFPGWLRLSTFCMRYTEKFAQSWRQEIEAMMARSAKKAD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtgctcacgggttgggaggctgtttcccgcgcgctgtacgccatcgggctcgtg
accgcgctctgctggggtctccagctggcccggtggtgctggggaggtttccgcgtgtac
gtgttgtcctccttctggaagacggacttgcgccagttcggacagtgggcggttgtcacc
ggagcgacatcggggattggcagggcctatgcagatgagttggccaggcgagggctggat
ttgatcctcatcagcaggtcaatagagaagctccacactgctgccaaggagatcgagagc
caatatgggagacagacacatgtcatccaagtggatttcacaaagggccccagcatctac
ccgatcatcgcagagaagctccagggcctggagatcggcattctgggtaatgtactcata
ccggggaccaaatacttgtgctggaggcaggcgttatcttgtaatcgtgaacagctgtca
tggtcgctgtgtgcagtgaacaacgtgggcatgaactacgcgggcatgttggtttacttc
ctggacgttcctgaccctgagaagagcatcactgatgtcatcaactgcaacatgctgtct
gtggcacagatgaccagactggttcttccacatatgttggagagacataaaggcctcatc
atcaatatatcctcagaggctgggtcacagccacagcccatgctggcgctgtattccgcc
accaaggtttttgtcacctacttgtctagatcactcactgctgaataccgaatgcaaggc
atcactgtacagtgtgtgaccccctgtgtcgtgtccacaaatatgacccacaatgttgag
gtgggccccctggtgaagagcgcatcagcttttgcttatgaagccctcaacacagtgggg
tactcaaattacacaagtggctgcctcctacatgccctccagcacatcgccctctgcatc
ttcttccctggctggctccggctcagcaccttctgcatgaggtacacagagaagtttgct
cagagctggcggcaggaaatcgaggccatgatggcaagatcggcgaagaaggcggactaa

DBGET integrated database retrieval system