KEGG   Scleropages formosus (Asian bonytongue): 108918826
Entry
108918826         CDS       T04919                                 

Definition
(RefSeq) TGF-beta receptor type-2-like isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04010  MAPK signaling pathway
sfm04060  Cytokine-cytokine receptor interaction
sfm04068  FoxO signaling pathway
sfm04144  Endocytosis
sfm04218  Cellular senescence
sfm04350  TGF-beta signaling pathway
sfm04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108918826
   04350 TGF-beta signaling pathway
    108918826
   04068 FoxO signaling pathway
    108918826
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108918826
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108918826
  09143 Cell growth and death
   04218 Cellular senescence
    108918826
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108918826
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfm01001]
    108918826
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     108918826
Protein kinases [BR:sfm01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   108918826
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 108918826
NCBI-ProteinID: XP_018581925
LinkDB
Position
24
AA seq 584 aa
MASSLFWAVTSVLLAAFCAQAPAFTNIQTNVCKWCDYSSPICEGNVCYSNCSLNSFCLLS
EEICVAIWKQNNGSVSVRTLCHHPQDAVDNIMISNYSSTECVMVPQPTEEGALFICGCVN
AHECNDKLIFEKGSNGLLKLQSKDVLPVVVISLLPPFLVAVIATMAFYLYRTRQSEKQPK
HRGPKRTQYQSLDMPEGHARGGSPNDYRGKPVAVNREALADSSTTCGNSLNHNMEQLPIQ
LEEVVGKGRFAEVWRARLIHSSTGQYETVAVKIFPAVEYNSWQSERTVFSDASLRHENVV
QFVSAEERMGRTGSPQREYWLIMAYHGMGNLQDFLAHHVLSWAELHAMAGSVARGLAHLH
SDFSPSGAPKVPVAHRDLKSSNIVVKNLRECALCDFGLALRLDLSLTVDDFANSGQVGTA
RYMAPEVLESRVNLEDPEAFKQMDVYSLALVLWEMVSRCDAIGEVKSYEPPFRSKVCDQP
CVESMRDLVLRDRGRPDIPTSWTAHQGVKVLCCTITECWDHDPEARLTAQCVVERFNAFG
EEEDSQDLFNNNQQQLTTMCVETQAHASPSTSSNKDTATPVEEV
NT seq 1755 nt   +upstreamnt  +downstreamnt
atggcttcgtcgctcttttgggccgtgacctccgtcctcctcgcggcgttctgtgcccag
gccccggccttcacaaacattcagacgaacgtgtgcaagtggtgtgattactccagccct
atttgtgagggcaacgtgtgctacagcaactgctccctcaactccttttgcctcctctct
gaagaaatctgtgtggccatatggaaacagaacaatgggagcgtcagcgtgcggacgctc
tgccaccatccgcaggatgccgtagataacatcatgatctccaactactcctccaccgag
tgtgtgatggtgccccagccaacggaggagggggcactgttcatctgtggctgtgtgaat
gcacacgaatgcaatgacaagctcatatttgagaagggctctaacggtctcttgaagctc
cagagcaaggatgtattacctgttgtggtcatcagcctgctccctccctttctggtggcc
gtcattgcaaccatggccttctacctttaccgcactcggcagtcagaaaagcagcccaaa
caccggggccccaaacgcacccagtaccagtccctagacatgcctgaaggtcatgctaga
ggagggtcacccaatgactaccgtggtaagccagtggccgtgaacagagaagcccttgct
gattcatccactacctgcggcaacagcctgaaccacaacatggagcaactgcctatccag
ctggaggaggtggtgggtaagggacgctttgctgaagtctggcgggcccgactcattcac
agtagcacagggcagtatgagacagtggcagtgaagatcttcccagcagtggagtacaac
tcgtggcagagtgagcggacggtcttttctgatgccagcctgaggcatgagaatgtagtc
caatttgtgagcgcagaggagcgaatggggaggactggctccccccaaagggaatactgg
ctcatcatggcttaccacgggatgggtaatctacaagacttcttggcacatcatgtactg
agctgggcagagctacacgctatggctggttctgtggctcggggattagcccatttgcac
agtgatttttcaccttctggggcacccaaagtaccagtggcccaccgggatctgaagagc
agcaacatcgtggtgaagaacctgcgcgaatgtgctctctgtgactttggcttggcgctc
aggcttgatctttctctcaccgtggacgactttgctaacagtgggcaggtagggacagct
cgctacatggcaccagaggttctggagtcacgggtcaatctagaggacccggaggccttc
aaacaaatggatgtctactctttggctttggtgctgtgggaaatggtctctcgttgtgat
gcaatcggggaggtaaagagctatgagccaccatttaggtcaaaggtgtgtgaccagcca
tgtgtggagagcatgagggacctggtgctgagggaccggggccgaccagacatccccacc
agctggactgcacaccagggagtgaaggtcttgtgttgtaccatcactgagtgctgggat
catgatcctgaggcccgtctgacagcccaatgtgtggtggaacgattcaatgcctttggt
gaggaggaggacagtcaagacctctttaataacaaccaacagcagctcactaccatgtgc
gtagagactcaggcccatgcctccccatctacctcctccaacaaagacactgctacaccg
gtggaggaagtgtga

DBGET integrated database retrieval system