KEGG   Scleropages formosus (Asian bonytongue): 108919375Help
Entry
108919375         CDS       T04919                                 

Gene name
exd2
Definition
(RefSeq) exonuclease 3'-5' domain-containing protein 2 isoform X1
  KO
K20777  exonuclease 3'-5' domain-containing protein 2 [EC:3.1.11.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108919375 (exd2)
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.1  exodeoxyribonuclease I
     108919375 (exd2)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     108919375 (exd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_A_exo1 RRXRR
Motif
Other DBs
NCBI-GeneID: 108919375
NCBI-ProteinID: XP_018582846
UniProt: A0A1W4XTZ9
LinkDB All DBs
Position
15
AA seq 635 aa AA seqDB search
MSRQSIFTATVAAVLGATLGGLLFWRSLCVRRKRIAQSQTEPDSAQREKTTAVEHEVDAV
PSGQPPPLSPSLMPVVPLLPSPEKLLEVLPVVVSSEDQWEELWPSLEKELSVYPVLGLDC
EWVKTQCVSVKGKSGPVSLLQMASYTGRCALVRLPLIHSVGQSLPNSLVKILNDSRVLKV
GVGCYEDGKRLARDYGLSLGCTVDLRYLVIRQRQMGLSNGLSLKSLAADLLNVPLDKSLE
LRCSDWEADKLTLEQVTYAARDAQVSIALFFHLLGLNSSLSSRSDDVFSQMLSRCHGLVD
VPFCGRGLEEGEEKSLDGERRRRSRRNTSDSSGSGSVSGDQQVPDPRKNRRKPLGVGYSA
RKSPLYDNCFLHAPDGQPLCTCDKKKAKWYLDKGIGELLSEDPFIVRLKFEPSGRPDSQQ
DYYLTAKENLCVVCGKTDSYIRKNIVPHEYRRHFPAEMKDHNSHDILLLCTSCHAASNVH
DGMLKQQLAEEFGAPLGCEEGVRLLEDSDRRRVRSAARALLTASDSLPQARRKELEDLIK
TFFGQEQQEITTEMLQKAVGLETRIFNQSYVPHGLKVVRAYAERGLRGLMELERRWRQHF
LSAMKPRHLHPLWSVNHNHAKFLRKYGEDLPIQLN
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagacagagtatctttactgctactgtggcagccgtgctgggtgccacccttggc
gggctgctgttttggcggtccctgtgcgtccgtaggaaacggatcgcgcagagccagact
gagccagactctgcacaaagggagaagaccacagcagtggaacatgaggtggatgctgta
ccatctgggcagccaccaccgctgtctccatcccttatgcctgttgtccctctactgcca
tctccggagaagcttcttgaggtgcttccggtggtggtgagctccgaggatcagtgggag
gagctgtggccatcccttgaaaaagagctgtctgtataccctgtgcttggccttgactgt
gaatgggtaaagacccagtgtgtttctgtgaaggggaagtcaggcccggtctccctgctc
cagatggcctcttacacaggccgttgtgcgctggtgcgcctgcctctgatccacagtgtg
gggcagtccctccccaacagtttagtgaagatcttgaatgactcgcgtgtgcttaaagtt
ggagtcggctgctatgaggatggcaagcgtttggcccgggactatggcttgtcacttggc
tgcactgtggacctgcgctaccttgttataaggcaacggcaaatggggctgagtaatggg
ctgagcctgaaatctctggcagcagatttgttgaacgtgccccttgacaagtcactggag
ctccgttgcagtgattgggaggcagataagctgacactggagcaggtgacctatgctgcc
cgtgatgcccaggtttccattgccttatttttccacctactgggcctgaactccagcctc
agctcccgctcagacgatgtcttctctcaaatgctgtcacgctgccatggcttggtggat
gtgcctttctgtggacggggcttggaggaaggagaagagaagagtctagatggggagcgg
cgtcgccgcagcagaaggaatacctcggatagctctggctccggctcggtttctggagat
cagcaggtgccagacccccggaaaaacaggcgcaagcctcttggggtggggtattctgcc
aggaagtccccactctatgacaactgtttcctccatgccccagatggtcaacccctttgc
acctgtgataagaagaaagccaaatggtatctggataagggaattggagagcttctgagt
gaagacccctttattgtcaggctaaaatttgaaccatcaggacgtccagactctcaacaa
gattattaccttactgctaaagagaacctgtgtgtggtgtgtggcaagactgactcttac
attaggaagaacattgtcccccatgaatatagacggcactttcctgctgagatgaaggac
cataactcccatgacatccttctcctatgcacatcctgccatgcggcctctaatgtccac
gatgggatgttaaagcagcagctagctgaggagtttggtgcacctctagggtgtgaggag
ggtgttcgcctgctggaggattcagacaggcggcgggtgcgctctgcagcccgtgccctc
cttactgccagtgacagtttgccgcaggcccgccggaaagagctggaggaccttatcaag
accttctttggtcaggagcaacaagaaatcaccacagagatgctgcagaaggcagttggc
ctggagaccaggatatttaaccaaagctacgtgccccatgggctaaaggtggtgcgtgcc
tatgctgagcgtgggctccgtggcctaatggagcttgagaggcgttggagacagcacttc
ctgtctgctatgaaacctcgtcacctgcaccctctctggtctgtaaaccacaaccatgcc
aagtttctccgaaagtatggagaggacctgcccatccagcttaactga

DBGET integrated database retrieval system